KEGG   Rahnella aquatilis HX2: Q7S_23196Help
Entry
Q7S_23196         CDS       T01850                                 

Definition
(GenBank) hypothetical protein
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFE60797
UniProt: H8NZV7
Position
PRA1:complement(94388..94639)
Genome map
AA seq 83 aa AA seqDB search
MKLLNNEFEYREWMHKDYLHLDEEFPSVFGPDELEREILRQAPKEFPCLAQIVEGEGANS
LQSVQFIYRSQIEEWAKLFGIVN
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgaagctactgaataacgaatttgaatacagagaatggatgcataaagactaccttcat
ttggatgaggagtttccttcggttttcggacctgacgagcttgaaagagagattctgcgt
caggcccccaaagaattcccttgccttgcacaaattgtagaaggcgagggtgccaactcc
ctgcagtctgttcaattcatatatcgatcccagatagaagagtgggcaaagctgttcggc
attgtgaactaa

DBGET integrated database retrieval system