KEGG   Rahnella aquatilis HX2: Q7S_23211Help
Entry
Q7S_23211         CDS       T01850                                 

Definition
(GenBank) hypothetical protein
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_21 AAA_15 SMC_N AAA_23 AAA_29 ABC_tran
Motif
Other DBs
NCBI-ProteinID: AFE60800
UniProt: H8NZW0
Position
PRA1:complement(95997..97283)
Genome map
AA seq 428 aa AA seqDB search
MAIIEGFRIKNYKALKDVSLGRFWNRQSDKPLTPMTAVIGKNGAGKSTLFDAFGFLADCL
KNGVEEACDARGRGGFERIRSKNQIGPIEFEIYYKQDGTARPITYELSIDLDSQSRPFVK
SERLRQRRLNQRRGWPFSFLVLNDGSGVAWKGEQAGVDESNDDFDLENLIKSISQGEDVE
ESNETEVVELQNKRLLGISTLGSLKQHPRISAFRNFIEGWYLSYFTPDAARSLPLAGPQK
HLNMHGDNLGNVVQFMEREHPRKFQSILSKISQRIPGIEKIDTEKTPDGRLLLKFNDKGF
VDPFYAHQMSDGTLKVFAYLLLLEDPSPPPFLCIEEPENGLYHKLLATLASEFREHATGK
KGGSQVFVTTHQPYLVDALVPEEVWILEKNAFGFSEIRRASEINLVESLVSEGVPLGGLW
YSEYLDDR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccatcatcgaaggttttagaattaaaaattacaaggccttaaaagatgtcagttta
ggtcgtttttggaacaggcaaagcgacaaaccgctaacccccatgacagcagtaataggg
aaaaacggcgcaggtaagagtacgttgtttgatgcatttggatttttagctgattgtcta
aaaaatggcgttgaagaggcatgtgacgcacgaggtcgcggtggttttgaacgtatacgc
tcaaaaaatcaaattggtccaattgaatttgaaatttactacaaacaagatggtactgct
cgcccgataacttatgagttatctatagatcttgatagtcaaagcagaccatttgtaaaa
agtgaaagacttagacagagaaggttaaatcaacgtagaggttggcctttttcttttctc
gtattaaatgatggtagtggtgtggcatggaaaggcgaacaggccggtgttgatgagtct
aatgatgattttgatcttgaaaatttaattaaatctatcagccaaggtgaagatgttgaa
gaatctaatgaaactgaagttgtggaacttcaaaataaaaggctattaggaatatcaaca
ttaggttcccttaaacaacatccaagaatatcagcctttcgaaatttcattgaaggatgg
tatcttagttatttcacacccgatgcagcaagaagtcttcccttagctggacctcaaaaa
catttgaatatgcatggggataacttaggtaatgttgtccaatttatggaaagagagcat
ccacggaaatttcaatcaattctttcaaagatttcacagaggataccgggaatagaaaaa
attgatactgaaaagactcctgacggaagattattgcttaagtttaacgataaaggtttt
gttgatccattttatgctcatcaaatgtctgatggaactctaaaagttttcgcttatttg
ttattgctcgaggatccatctcctccaccatttctttgcattgaagagccagaaaatgga
ctttatcataagcttctggcgactttggcttcagagtttcgtgagcatgcaacagggaaa
aaaggtggttcacaggtttttgttactacccatcaaccctatctggtcgatgctctcgtg
ccggaagaagtgtggattctcgagaagaacgcctttggattttcagaaatcagacgcgca
agcgagatcaatttagttgaatcacttgtaagtgaaggggtcccattgggtgggctttgg
tacagtgaatatttggatgatagataa

DBGET integrated database retrieval system