KEGG   Rahnella aquatilis HX2: Q7S_23216Help
Entry
Q7S_23216         CDS       T01850                                 

Definition
(GenBank) antitermination protein from phage origin
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_antitermQ Sigma70_r4_2 DUF1133
Motif
Other DBs
NCBI-ProteinID: AFE60801
UniProt: H8NZW1
Position
PRA1:complement(97386..97733)
Genome map
AA seq 115 aa AA seqDB search
MRDINETLELWGAWAASDNSGVDFSPIAAGFKGLLPQITKSRLHCGDDEGIMIDGCVARL
KKYRYDEYELLILHYVFNISLRSIARRRRCSDGTVRKEMQTAQGFIGGCLAILNK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatattaatgagacattagaactttggggcgcatgggcagccagcgacaatagt
ggtgtagatttttctccgattgctgccgggtttaaggggttacttccacaaataactaag
tcaagattacattgcggtgatgatgaaggcatcatgattgatggatgtgtagcacgactg
aaaaaatacagatacgacgaatacgaattgctaatcttgcattacgttttcaatatttct
ctgaggtcgatcgcgaggagaaggagatgctcagatggcactgtaaggaaggaaatgcag
actgctcaaggatttattggtggatgcttggcaatactgaataaatga

DBGET integrated database retrieval system