KEGG   Rahnella aquatilis HX2: Q7S_23271Help
Entry
Q7S_23271         CDS       T01850                                 

Definition
(GenBank) excisionase
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exc HTH_17
Motif
Other DBs
NCBI-ProteinID: AFE60812
UniProt: H8NZX2
Position
PRA1:105309..105551
Genome map
AA seq 80 aa AA seqDB search
MTRTLTLDEWALEEFSAPIPSRPTLMRYAKNGMIYPLPFKAGRCWRVEASARFIGIAEKP
VINKDIDPRLMRILEDGTST
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgacgagaacattaacgcttgatgaatgggctctcgaagagttttccgcgccaatccct
agcagaccaacgctgatgaggtatgcgaaaaatggaatgatataccccctgccctttaaa
gccgggcggtgctggcgtgttgaagcatcagcgcgtttcattgggatagctgagaagcct
gtgatcaacaaggatatagatccacgtttaatgaggattctcgaagatggcacgtccacg
taa

DBGET integrated database retrieval system