KEGG   Rahnella aquatilis HX2: Q7S_23311Help
Entry
Q7S_23311         CDS       T01850                                 

Definition
(GenBank) lipoprotein
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4223
Motif
Other DBs
NCBI-ProteinID: AFE60820
UniProt: H8NZY0
Position
PRA1:113072..113239
Genome map
AA seq 55 aa AA seqDB search
MKNLFKLALLAAVVTTLSGCTGSVFNKEKNCDYTYLLHPAISISKMIGGCGPAEK
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacttatttaagttagctcttctcgctgcggtagttacgacactttcaggctgt
accggtagcgtttttaataaagagaaaaattgtgactatacttatttgctgcaccctgcg
atttcaatttctaaaatgatcgggggttgtggtccggcagagaaataa

DBGET integrated database retrieval system