KEGG   Rahnella aquatilis HX2: Q7S_23316Help
Entry
Q7S_23316         CDS       T01850                                 

Definition
(GenBank) hypothetical protein
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGE-sulfatase Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 DinB_2 DREV CheR TehB
Motif
Other DBs
NCBI-ProteinID: AFE60821
UniProt: H8NZY1
Position
PRA1:complement(113537..115678)
Genome map
AA seq 713 aa AA seqDB search
MLSTQNKAIGLPEPTQTILLSTGTAEEKRQEIRDYFIQTWELYESLFDCLADERAYFNKA
ISLRHPLIFYFGHTATFYINKLMAAGLIPQRVDSHIEAMLAIGVDEMSWDDLDDQNYNWP
SVVNLRQYRDKVREEVLGIIDTMALSLPIGWDSPAWVILMGIEHERIHLETSSVLIRQLP
VEWVKPQSHWPVCGIARHDRNSVPDNTMLAVKGDIVTLGKQDDTYGWDNEYGTSQQKIQA
FSASKMLVSNAEFYTFIQADGYHDAQWWDEEGLGWRDFARAEMPTFWVGSPREPERLKLR
LMTEEVPMPWDWPAEVNQLEAAAFCRWKAAQTGESVQLPTEAEWMILRNQVQGDQPDWET
APGNINLAWWASSCPVDHFEQGDFYDVVGNVWQWASTPISGFDGFRVHPLYDDFSTPTFD
GKHSMIKGGSWISTGNEALKSSRYAFRRHFFQHAGFRYVISSHQEVVKVNPYETDGLVAQ
YLDFQYGPRHFDVTNYAVQLVDIAVENTVNRGRALDIGCATGRASFELARHFDSVVGMDY
SARFIDVALALARGEACRYVIPEEGELVDYCQASLADVNISAEQTVRVNFVQGDACNLKP
QAELYDLVLAANLLDRLREPARFLTDITPMIRSGGLLMLSSPYTWLEEFTPKEHWLGGFR
ENGEAVTTHQALKRLLASGFEEVRQPADVPFVIRETARKFQHTVAELTLWRKR
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgctttcaacacaaaacaaggctatcgggttgccagaaccgacgcagaccattttgcta
agcaccggaacagcggaagaaaaacgtcaggaaattcgcgattatttcattcaaacctgg
gagctgtacgagagcctgtttgattgtctcgctgatgaaagagcctatttcaataaggca
atttcgcttcgccacccgctgattttttatttcggtcataccgccactttttatattaat
aagctgatggctgcggggctgattcctcaacgtgttgattcacacatcgaagcgatgctg
gcgatcggtgtggatgaaatgagctgggatgatctcgacgatcagaactataactggcca
tcagttgttaacttgcgtcaataccgcgacaaagtacgtgaagaagtgctcggtattatt
gacaccatggcgctgagtttacccatcggatgggacagccctgcctgggtgattctgatg
ggcattgaacatgagcgcattcatctggaaacatccagtgtattgatccgtcagttgccg
gtggaatgggttaagccacaatctcactggccggtgtgtggaatcgcccgtcatgaccgc
aacagcgtacctgataacactatgctggcggtgaaaggtgacattgtcacgttgggtaag
caggatgatacctacggctgggataacgaatacggcacatctcaacagaaaattcaggca
tttagtgccagtaagatgctggtcagtaacgctgaattttatactttcatacaggcggac
ggctatcacgatgcccagtggtgggacgaagaagggcttggctggcgggattttgcgcgg
gctgaaatgcccactttctgggtgggttcgccccgggaacctgaacggctgaaacttcgc
ctgatgacggaagaagtgccgatgccatgggactggcctgctgaagttaatcaactggaa
gcggcagcattctgtcgctggaaagcggcgcagaccggtgaatcagtacagttgccgact
gaagctgaatggatgattctgcgtaatcaggtgcagggtgatcagccagactgggaaaca
gcaccgggaaatatcaacctcgcatggtgggcatcatcctgtccggttgatcatttcgaa
caaggtgatttttatgatgttgtggggaatgtctggcaatgggcgtctacgccgatcagt
ggatttgacggctttcgtgttcatcctttatatgatgatttttcgacgccaacattcgat
ggtaaacattccatgatcaaaggcggaagctggatttcaacgggcaatgaagcgctaaaa
tcttcgcgttatgcttttcgtcgccactttttccagcatgccggtttccgctatgtgatt
tccagccatcaggaagtggtgaaagtgaatccttatgaaactgacgggctggtggcgcag
tatcttgatttccagtacggtccgcgtcatttcgacgtaacgaattatgcagttcaactg
gttgatattgcagttgaaaatacagttaatcgtggcagggcgctggatatcgggtgtgct
acgggacgtgccagttttgaacttgcacgtcatttcgactctgtggttggaatggattat
tccgcgcgatttattgatgtcgctctggctctggcacgcggtgaagcctgtcggtatgta
atcccggaggagggcgaactggtggattattgccaggcttcgctcgctgatgtcaatatc
tcagcagagcagacagtgcgggtgaattttgtgcagggtgatgcctgtaacctgaagccg
caggcggaattatacgatctggtcctggcggctaatttgctggatcgactgcgtgaacct
gcacgttttctgacagatattacgccaatgattcgttctggcggcttactcatgctttct
tcaccttacacctggctcgaagagtttacaccgaaagagcactggctgggcgggttccgg
gaaaatggtgaagctgttacgacgcatcaggcgttgaaacgtttgctggcgagtggattt
gaagaggttaggcaaccggcagatgttccgtttgtgatccgtgaaacggcgaggaaattc
cagcataccgtagcggaacttacactgtggcgtaagcggtaa

DBGET integrated database retrieval system