KEGG   Rahnella aquatilis HX2: Q7S_23321Help
Entry
Q7S_23321         CDS       T01850                                 

Definition
(GenBank) integrase family protein
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase Phage_int_SAM_3
Motif
Other DBs
NCBI-ProteinID: AFE60822
UniProt: H8NZY2
Position
PRA1:complement(115825..116949)
Genome map
AA seq 374 aa AA seqDB search
MSKIGSVTTVEGDFAAGNVGQHVLAYLQNVKMTPLAKLDDFDEEGNATVGQVINIWIRLS
LILTRRRPEIAVSSLMKHVLPVIGEVPLNKITRLRLNRLFNVLLADGKVSEAKRVFALCK
QFFGWAETQGYLAHSPLSTMKRRDVGGRNTPPRERTLTDAEIWVFWHSLDLWDISEQCRW
ALRLCLLTARRPDEVVRARKDEFHLQIGIWRQGTRNKSARDHNLPLTPLMITCINALLSA
SPKHSPWLVPSPLDAQRPLSRGAVTQVIRRLLRAERGPGIDAFTTRDLRRTARSKLSSLN
VPNDVARKIMNHSLEGIDRVYDTHDYLPQMKQALEAFSDNIQGIIDAPDYYDLRHHFEGE
SLHVRESSLLFMER
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagatcggatccgtaacaacagtcgaaggagattttgctgccggaaatgttggt
cagcatgttttggcttatctgcagaatgtgaaaatgacaccgcttgccaaactggatgat
tttgatgaggagggcaatgcaacggtcgggcaggtgatcaatatctggatccggctttca
ctgatcctgacacgacgccggccagaaattgctgtttcatccctgatgaaacatgtgttg
ccagtgatcggcgaagtgcctctgaataaaatcacccgtttacgactgaaccgtttgttt
aatgtactgctggcggacgggaaagtttcagaagcaaaacgggtattcgcgctttgtaag
caattttttggctgggcagaaacccagggatatctggcacattcgccactaagtaccatg
aagcgccgcgacgtcggcggccggaataccccgccacgcgaacgaacgttaaccgatgct
gaaatctgggttttctggcatagccttgatttatgggatatttctgaacaatgtcgctgg
gcattgcgcttgtgcctgctgactgcacgacgaccagatgaagtggtgcgcgccagaaaa
gatgagttccatttgcagatcggcatctggcgacagggtacgcgcaataaatcggcccgt
gatcacaacctgccgctgacgccattaatgatcacctgcatcaatgctcttctatcagcc
agtccgaaacacagtccctggctggtgccttcaccgctcgatgcacaaagaccgttatca
cgcggtgcggtgacacaggttatacgccgcctgctacgtgcggaacggggtccggggatt
gatgcttttaccacccgtgatttacgccgtacggcgcgttccaagttatcctccctgaat
gtgccgaatgatgttgcgcgcaaaattatgaatcattcgcttgaagggatcgaccgtgtt
tatgacactcacgattatctgccgcagatgaaacaggcgctggaagcattttctgacaat
attcagggcatcattgatgcaccagattactacgatttacgtcatcattttgagggcgaa
tctctgcatgttcgtgaaagttcgctgttgtttatggagagatag

DBGET integrated database retrieval system