KEGG   Rahnella aquatilis HX2: Q7S_23331Help
Entry
Q7S_23331         CDS       T01850                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer
  KO
K05876  methyl-accepting chemotaxis protein III, ribose and galactose sensor receptor
Organism
raa  Rahnella aquatilis HX2
Pathway
raa02020  Two-component system
raa02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:raa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Q7S_23331
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Q7S_23331
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:raa02035]
    Q7S_23331
Bacterial motility proteins [BR:raa02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Q7S_23331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal TarH HAMP DUF948 GAT HAUS6_N
Motif
Other DBs
NCBI-ProteinID: AFE60824
UniProt: H8NZY4
Position
PRA1:complement(118976..120523)
Genome map
AA seq 515 aa AA seqDB search
MSLKKSSLLVLVILFALFFTSMLSNVWLLTRSNHSLDDVNKEIRVVLSIIDPINHSRTSR
VRVMEYMKEIENGDGQQSKSALDGVTEVIGKADAAFQTYLDVPKLPGESELADEYRNTYQ
DYRQNGIQPLIDAAKSGDQAAFKARIPAVVKLDRQYEIVLDKVLALHEQYAKNLNNVAQS
HFKFGIGLTVGFGLLFLIIIISVLVLMKRFVLLPLLSSRDHCRQIAEGYLDTPVPVKAKS
RSEIEELMQSIEHMRQSLTRIIRQVRDTSHTVAHASQEISAGNIDLASRTEQQAAALTQT
AASMEELGATVKQNTENVSRASSLTREAVQNARAGEKVAQDVIGTMGRINSSSKKIEDIT
GVINSIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSAMAAKEIESLISESV
ANIREGSDEVSRTGDSISAIISSVTQINILMEHISIASDEQSRGISQIEQAVTEIDGVTQ
QNAALVQESAAAAASLEEQVLHLTRSVSAFRLATV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttaaaaagtcgtctttacttgttcttgttattcttttcgcactctttttcacc
agtatgctttcgaatgtttggctgctcacccggagtaatcattcactggatgatgtgaac
aaggaaatccgtgtggtgctttctattatcgaccccattaaccacagccgaacctcgcgt
gttcgcgtgatggaatatatgaaagaaattgaaaatggagacggtcagcagtcaaaatct
gctctggacggagtcactgaggtcatcggtaaagccgatgcggcgtttcagacgtatctt
gatgtgccgaaattgcctggtgaaagtgaactggccgatgaataccgcaatacgtaccag
gactatcgccagaacggtatccagcccttgattgacgctgcaaagtccggtgatcaggca
gcgttcaaagcccggatccctgcggtggtgaaactcgatcgtcagtatgaaatcgtgttg
gataaagtgttggccctccatgaacagtacgcaaaaaatcttaataatgttgcacaaagt
catttcaaatttggtatcggtttgacggtcggttttggtttgttatttctgatcatcatt
atcagtgttctggtgttaatgaagcgctttgttctgctaccgctgctgagttctcgcgat
cactgccgtcagattgctgaaggttatctcgatacgccagtaccggtgaaggccaaatcc
cgcagtgagattgaagagttgatgcagtcgatagaacatatgcgtcagtcgctgaccaga
attataaggcaggtacgcgacaccagccataccgtggcgcatgcatcgcaggaaatctcc
gcaggtaatattgatctggcttcccgcactgaacaacaggccgcagcgctgacacaaacc
gccgccagcatggaagaacttggtgcgacggtaaaacaaaataccgaaaatgtctcccgg
gcaagcagtctgacacgtgaagctgtccaaaacgcgcgcgcaggcgagaaagtcgctcag
gacgtgattggtacgatggggcgtattaacagcagttcgaaaaaaatcgaagatattaca
ggtgtgatcaatagtatcgcttttcagacaaacattctggcgctcaatgccgctgttgaa
gcggcacgcgcgggtgagcaggggcgtggatttgcagtggtggccagtgaagtgcgcagt
ctggcgcagcgcagcgccatggcagcaaaagaaatcgaaagtctgatttctgaatcggtg
gcgaatattcgcgaagggtcggatgaggtctcacgcaccggcgattccatttcagcgatc
atttcctctgtcactcagattaatatattaatggaacatatctcgatagcctctgatgaa
caaagccgcgggattagccagattgaacaggcggtgacagaaattgatggcgtgacgcaa
caaaacgcagcgctggttcaggaatcggctgccgcagcggcctcgctggaagaacaggtt
cttcatctgacccgctcagtatcagcgttcagactggcaacagtgtaa

DBGET integrated database retrieval system