KEGG   Rahnella aquatilis HX2: Q7S_23336Help
Entry
Q7S_23336         CDS       T01850                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
raa  Rahnella aquatilis HX2
Module
raa_M00334  Type VI secretion system
Brite
KEGG Orthology (KO) [BR:raa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raa02044]
    Q7S_23336
Secretion system [BR:raa02044]
 Type VI secretion system
  Imp/Vas secretion system core components [MD:M00334]
   Q7S_23336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: AFE60825
UniProt: H8NZY5
Position
PRA1:121369..121863
Genome map
AA seq 164 aa AA seqDB search
MSNSFQNEIPKARVNIKLDLHTGGAQKKVELPLKLMVMGDYSNGKENRPLSEREKVNINK
NNFNSVLAEFSPSLNLTVENTLTGDRSEENISLNFNEMKDFEPEQVARQIPQLRAMLAMR
NLLRDLKSNLLDNVTFRKELEAILKDPALSNELRTELNALAPKA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatagcttccagaatgaaattccgaaagcgcgcgttaacataaaacttgatcta
cacactggcggcgcacagaagaaagtcgaattaccgttaaaattgatggtaatgggtgat
tacagtaatggaaaagagaaccgtccgttatctgaacgcgaaaaagttaacattaataag
aataactttaacagcgtactggctgaattcagcccttcactgaacctgaccgtggaaaat
acgctaacaggtgatcgcagcgaagaaaatatctctctaaatttcaatgaaatgaaagat
tttgagccagaacaggttgcccgtcagatcccccaactgcgcgcgatgctggcaatgcgt
aacttattacgtgacctcaaatccaatctgctcgacaacgtcaccttccgtaaagagctc
gaagccattctaaaagatcctgcgctgagcaatgaactgcgcactgaacttaatgccctg
gcgccaaaggcgtaa

DBGET integrated database retrieval system