KEGG   Rahnella aquatilis HX2: Q7S_23341Help
Entry
Q7S_23341         CDS       T01850                                 

Definition
(GenBank) type VI secretion protein, EvpB/VC_A0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
raa  Rahnella aquatilis HX2
Module
raa_M00334  Type VI secretion system
Brite
KEGG Orthology (KO) [BR:raa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raa02044]
    Q7S_23341
Secretion system [BR:raa02044]
 Type VI secretion system
  Imp/Vas secretion system core components [MD:M00334]
   Q7S_23341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: AFE60826
UniProt: H8NZY6
Position
PRA1:121895..123442
Genome map
AA seq 515 aa AA seqDB search
MLMSVNTENSSSSQTTVLDRPDAGTVYASLFDKINLTPVSSLGDLNDFQDTSALADVTAD
QRVTAAVQVFLERLKLSGQTVERLDKTLLDHHIAELDSQISRQLDVVMHHPEFQRIESGW
RGLKFLVDRTDFRQNVKIELLDVSKDDLRQDFEDCPEIIQSGLYRHTYIQEYDTPGGEPI
GSVISNYEFDASAQDVALLRNISKVSAAAHMPFVGAVGPKFFLKDSMEEVAAIKDIGNYF
DRAEYIKWKSFRDSDDSRYIGLTMPRVLGRLPYGPDTVPVRSFNYVEEVKGPDHEKYLWT
NAAFAFAANMVKSFIKNGWCVQIRGPQAGGAVTDLPIHLYDLGTGNQVKIPSEVMIPETR
EFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTANATANSRINARLPYIFLLSRIA
HYLKLIQRENIGTTKDRRLLELELNTWIRTLVTEMTDPGDDLQASHPLRDAKVTVEDIED
NPGFFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgctcatgtcagtcaacactgaaaactcttcttccagccagacaacggttctggatcgc
cctgacgccggtacggtatacgcttccctgtttgataaaatcaacctgacgcctgtgtcc
tcactgggtgatctgaacgattttcaggatacgtctgcgctggccgatgtcaccgctgat
cagcgtgtcactgccgctgtacaggtcttccttgagcgcctgaagctgtccggtcagacg
gttgaacgtctggacaaaaccctgctcgatcatcatatcgccgaactcgacagccagatc
agccgtcagttggatgtggtcatgcatcacccggaatttcagcgtattgaatccggctgg
cgtggtctgaagttcctggttgatcgtactgatttccgccagaacgtaaaaattgaactg
ctggatgtgtctaaagacgacctccgtcaggacttcgaagattgtcctgagatcatccag
agcggcctgtaccgccatacctacattcaggaatatgacactccgggcggcgagccaatc
ggttctgtgatttccaactacgagtttgacgcgtcggcgcaagatgtcgccctgctgcgt
aacatttctaaagtatctgccgctgcgcatatgccattcgtcggtgcggtcggccctaaa
ttcttcctgaaagattccatggaagaagtggcggcgattaaagatatcggcaactacttt
gaccgtgcggaatacatcaagtggaaatccttccgcgattctgacgattcccgctatatc
ggtctgaccatgccgcgcgtactcggtcgcctgccgtatggtccggataccgttcctgtt
cgcagcttcaactacgttgaagaagtgaaaggtccggatcacgagaaatatctgtggaca
aacgcggcgttcgcctttgcggccaacatggtgaaaagcttcatcaaaaatggctggtgt
gtgcaaatccgtggcccacaggcgggcggtgcagtgactgatctgccgatccatctgtac
gatctcggcaccggcaatcaggtgaaaatcccgtcagaagtgatgatcccggaaacccgc
gaatttgaatttgccaatctgggctttatcccgctgtcttactacaaaaaccgcgattac
tcctgcttcttctccgcgaactctgcgcagaaaccggcgctgtacgatactgccaatgcc
actgcaaacagccgcatcaatgcacgcctgccgtacatcttcctgctttcacgcatcgca
cactacctgaagctgattcagcgggaaaatatcggcaccaccaaagaccgtcgtctgctg
gaactggaactgaacacctggatccgtacgctggtcactgaaatgactgacccgggcgac
gacctgcaagcctctcacccgctgcgtgacgccaaagtgaccgtcgaagatatcgaagac
aacccgggcttcttccgcgtgaaactgtacgccgtaccgcacttccaggtggaagggatg
gacgtgaatctgtcactggtttctcagatgcctaaagcgaaagcgtaa

DBGET integrated database retrieval system