KEGG   Rahnella aquatilis HX2: Q7S_23361
Entry
Q7S_23361         CDS       T01850                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
raa  Rahnella aquatilis HX2
Pathway
raa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:raa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Q7S_23361
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raa02044]
    Q7S_23361
Secretion system [BR:raa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Q7S_23361
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AFE60830
UniProt: H8NZZ0
Position
PRA1:127189..127680
AA seq 163 aa
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQDHNLYIPTDNNTGKLTGTRIHTPFL
FTKEIDSSSPYLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKLVKVAPKMHD
IKDPAKEKHNHLEAIELRYEKITWTYKDGNIIHSDSWNERTTA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaattcctgtttatctgtggctgaaagacgacggcggtgcggacattaaaggctcc
gtagacgttaaagatcgcgaaggcagcatcgaagtggttgcacaggatcacaacctgtat
atcccgaccgataacaacaccggcaaactgacgggtactcgtattcacaccccgttcctg
tttaccaaagaaatcgattcctccagcccgtacctgtacaaagcggtgaccactggccag
acccttaaatctgctgagttcaaatggtatcgcatcaatgacgcgggccaggaagtggag
tatttcaacactaaactcgaaaacgtcaagctggtaaaagtcgcgccaaaaatgcacgac
atcaaagatccggctaaagagaaacacaaccacctcgaagctatcgagctgcgttacgaa
aaaatcacctggacctacaaagacggcaacatcattcattccgattcctggaacgaacgt
actaccgcgtaa

DBGET integrated database retrieval system