KEGG   Rahnella aquatilis HX2: Q7S_23516Help
Entry
Q7S_23516         CDS       T01850                                 

Definition
(GenBank) extracellular solute-binding protein family 5
  KO
K02035  peptide/nickel transport system substrate-binding protein
Organism
raa  Rahnella aquatilis HX2
Pathway
raa02024  Quorum sensing
Module
raa_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:raa00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Q7S_23516
Transporters [BR:raa02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Q7S_23516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5 Band_7
Motif
Other DBs
NCBI-ProteinID: AFE60857
UniProt: H8P017
Position
PRA1:complement(165099..166613)
Genome map
AA seq 504 aa AA seqDB search
MKQKHFNVVAAGVLLALSLVSEMAQAAGVLTIGRREDSTTFDPIKSAQNADNWVFSNVFD
PLVRVDNTGTKLLPGLAESWTISPDGKTYTLKMRDAKFSDGTPVTASDAVFSLTRIRDDA
GSLWKDSYSIIDTLKAPDAHTLVITLKTPSAAFLSQLALPNASVISQQALTKQGADDFAE
HPVGSGAFSVKEWTRGEKVELVKNPYYWDAAKVKLDGVEWLTLPDDNTRMLKVQAGEIDA
ALSIPFSRISSLQKDPKLAVELDTSTREDHLLINHSHGDLGKVEVRQALDFAIDKKAIID
TVTFGYGKIANSYIPDGALYHYADNLQRPYDPEKAKQLLAAAGVKNLTLKYLVNAGDEVD
EQIAVLLQQQLAKAGITANLQKVDPSQSWDMLVAGDYDISVMYWTNDILDPDQKTTFTLG
HDSNMNYMTRYHNDKVKALVAAARVEMDPKKREQMYIDLQKMAKADVNWIDLYYSPYRNV
TRKNIKDFHQNPLGRFTLEETVKE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaagcattttaacgttgtggccgccggggtgctgctggcgttgagtctggtc
agcgaaatggcgcaggctgcgggggtactgaccatcggccgtcgtgaagacagcaccaca
tttgacccgatcaagtcggcgcaaaacgccgataactgggtgttctccaacgtgttcgat
ccgctggtgcgcgttgacaataccggcaccaaactgctgccgggcctggctgaaagctgg
acgatttcgccggacggtaaaacctatacgctgaaaatgcgcgacgcgaaattctctgac
ggcacgccggtgaccgcctctgatgctgtgttcagcctgacgcgtatccgtgatgacgcc
ggatcgctgtggaaggattcatacagcattatcgatacgttgaaagcccccgatgcccat
acgctggtgatcaccctgaaaacgccgtcggcagcattcctttctcaactggcactgccg
aatgcctcggtgatttcgcagcaggcgctgaccaaacagggcgcggatgattttgccgaa
cacccggtgggttccggcgcgttcagcgtgaaagagtggacgcgcggtgagaaagtcgaa
ctggtgaagaacccgtactactgggacgccgcaaaagtgaaactcgatggcgtcgagtgg
ctgacgctgccggacgacaatacccgcatgctgaaagtgcaggccggagaaattgacgcg
gcactgtcgattccgttctcgcgcatttcatcgctgcaaaaagacccgaaactcgccgtc
gaactggatacgtcaacccgtgaagatcacctgctgatcaaccattctcacggtgacctg
ggcaaagtggaagtgcgtcaggcgctggacttcgccatcgataaaaaagccattattgat
accgtgacgtttggttacggcaaaatcgccaactcctacatccctgatggcgcgctgtat
cattacgctgacaacctgcaacgcccgtacgacccggaaaaagccaaacaactgctggcc
gccgccggagtgaaaaatctgaccctgaaatatctggtgaatgccggtgatgaagtggat
gaacagattgcggtattgctgcaacagcaactggcaaaagccgggatcactgccaacttg
cagaaagtggatccgagccagagctgggacatgttagtggcgggggactatgacatttcg
gtgatgtactggacgaacgacattctcgaccctgatcagaaaaccacctttacgctgggc
catgactcgaacatgaattacatgacgcgttatcacaatgacaaagtgaaagcgctggtg
gccgccgcgcgggtggagatggatccgaagaagcgtgaacagatgtacatcgatttgcag
aaaatggcgaaagccgatgtgaactggattgatctgtattacagcccgtaccgcaacgtg
acccgtaaaaatatcaaagatttccaccagaatccgttagggcgcttcacactcgaggag
acggtgaaagaataa

DBGET integrated database retrieval system