KEGG   Rahnella aquatilis HX2: Q7S_23541Help
Entry
Q7S_23541         CDS       T01850                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K07782  LuxR family transcriptional regulator, quorum-sensing system regulator SdiA
Organism
raa  Rahnella aquatilis HX2
Pathway
raa02020  Two-component system
raa02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:raa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Q7S_23541
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Q7S_23541
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:raa03000]
    Q7S_23541
Transcription factors [BR:raa03000]
 Prokaryotic Type
  Helix-turn-helix
   LuxR family
    Q7S_23541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Autoind_bind GerE Sigma70_r4_2 HTH_38 Sigma70_r4 HTH_23 HTH_20 HTH_24 HTH_40 HTH_11 MarR KorB MarR_2 LacI
Motif
Other DBs
NCBI-ProteinID: AFE60862
UniProt: H8P022
Position
PRA1:170624..171379
Genome map
AA seq 251 aa AA seqDB search
MKLAVQESAVSLRETTVDGAFDQLFAQTSRLGFDALIYDYTPVPRSLEGELITPSLLRMC
NVPGDMQRLWLENGYYQVDPVQHYALESCAPFVWSYQRPDNTSLQNRLSDLNKPVTHYMC
DNNMPSGATVPLHLPNGGFVTVTGIHTGAGHELDIHDVLAELSLLALTFQECVFPLFDSS
ILTCRHVRLSKRERECLTWAAEGLTAKEIARKLNRSIATVTLHLNTAARKLGASNRVQAV
VRAMHYRLLDS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgcggtgcaagagagtgcagtgtctttgcgggaaacgaccgttgatggtgcg
tttgatcagcttttcgctcagacctcgcgcctggggtttgacgccctgatttacgactac
acgccggtaccgcgttcgcttgagggcgagctgatcacaccgtcgctgttgcggatgtgt
aatgtgcccggcgacatgcagcggttatggctggagaacgggtattatcaggtcgatccg
gtgcagcattacgctctcgaaagctgcgcaccgtttgtctggtcttatcagcgcccggac
aatacctcgctgcaaaaccgcctcagtgacctcaacaaaccggtcacccattacatgtgc
gataacaacatgccgagcggcgcgacggtgccgttgcatttgccaaatggtggatttgtg
acggtcaccggcattcacaccggtgcgggacatgagctggatattcatgatgtattggcc
gaactgagcctgctggcgctgacctttcaggagtgcgtgtttccgctgttcgacagcagc
attctcacctgtcgccacgtgcgcttaagcaagcgcgaacgcgaatgtctgacgtgggcg
gcagaaggcttaaccgccaaagagatcgcccgcaaactcaaccggtcgattgccaccgtc
acgctccatctcaataccgccgcccgcaaactgggggccagtaaccgtgtgcaggccgtg
gttcgcgcgatgcattaccgtttactcgacagttaa

DBGET integrated database retrieval system