KEGG   Rahnella aquatilis HX2: Q7S_23561Help
Entry
Q7S_23561         CDS       T01850                                 

Definition
(GenBank) cytochrome bd ubiquinol oxidase subunit I
  KO
K00425  cytochrome bd ubiquinol oxidase subunit I [EC:1.10.3.14]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00190  Oxidative phosphorylation
raa01100  Metabolic pathways
raa02020  Two-component system
Module
raa_M00153  Cytochrome bd ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:raa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Q7S_23561
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Q7S_23561
Enzymes [BR:raa01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.14  ubiquinol oxidase (electrogenic, non H+-transporting)
     Q7S_23561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_I DUF4235
Motif
Other DBs
NCBI-ProteinID: AFE60866
UniProt: H8P026
Position
PRA1:175266..176699
Genome map
AA seq 477 aa AA seqDB search
MFGLDAFHLARIQFAFTVSFHIIFPAITIGLASFLAVLEGMWLKTGNRSYRDLYHFWSKI
FAVNFGMGVVSGLVMAYQFGTNWSGFSQFAGSITGPLLTYEVLTAFFLEAGFLGVMLFGW
NRVGPGLHFFATCMVALGTLISTFWILASNSWMHTPQGYEIVNGVVVPTDWFKVIFNPSF
PYRLFHMSIAAFLASAFFVGASGAWHLLRGNDTPAVRKMFSMALWMALIVAPIQAMVGDA
HGLNTLEYQPAKIAAIEGHWENPPGEATPLILFGVPDMEQERTKYALEIPYLGSLILTHS
LQKQVPALKDFPKEDRPYSPVVFWSFRIMVALGLLMITAGVLGVWLRYKKRLYQSRPFLW
FTLLMGPSGLIALLAGWFTTEIGRQPWVVYGVQRTRDAVSAHGEMHMSLSLLAFLLVYSS
VFGIGYVYMMRLIKKGPVTGEGDEVSHGGPGKPNTPARPLSAAQEGLSNPEGSKKYD
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtttggattagatgcttttcacctggcaagaatacaattcgcattcaccgtgtctttt
cacatcatatttcctgccattacgatcgggctggccagttttcttgcggtgcttgaaggg
atgtggctgaaaaccggcaaccgcagttaccgggatctgtatcatttctggtccaaaatt
tttgctgttaactttggcatgggggtcgtgtcaggtctggtgatggcctatcagttcggc
accaactggagcggattctcgcaatttgccggtagcattaccggccctttactgacctat
gaagtgctgaccgcatttttcctcgaagccggttttctgggcgtgatgttgtttggctgg
aaccgggtggggcctggcctgcatttctttgcgacctgtatggtggcgctgggcacgctt
atctccaccttttggatcctggcatcgaacagctggatgcatactccgcagggctatgaa
attgtcaatggcgtcgtggtgccgacggactggtttaaggtcatttttaacccgtcattt
ccttatcgtctgttccatatgtccatcgcggctttcctcgccagtgcgttctttgtgggg
gcttccggtgcctggcacctgcttcgcggcaatgatacgccagcggttcggaaaatgttt
tccatggcattgtggatggcgctgatcgtcgcccccattcaggcaatggtcggtgacgcc
cacggactgaatacgctggaatatcagcccgccaaaattgcggccattgaagggcactgg
gaaaatccgcccggggaagccacaccgttaattctttttggcgtcccggatatggagcag
gaacgcacgaaatatgcgctggagatcccttatctgggcagtctgatcctgacacatagc
ctgcaaaaacaggtgcccgcgctgaaggattttccgaaagaagatcgtccctattcgccg
gtagttttctggtctttccgcatcatggtcgcgctcggtctgctgatgatcacggcaggc
gtgctgggtgtgtggctgcgttataaaaagcggctttatcagtcccgcccgttcctttgg
ttcacgctgctgatgggaccttccggtctgattgccctgcttgcgggctggtttaccact
gaaattggccgtcagccgtgggtggtttatggcgttcagcgcacccgcgatgccgtctcc
gcacacggtgaaatgcacatgagcctcagcctgttagctttcctgctggtgtactcgtcc
gtttttggtattggctacgtttacatgatgcgtcttatcaaaaaagggccggtgaccggt
gaaggtgatgaggtttctcacggtggaccaggtaagccaaacacaccggcgcgtccgctg
tctgcggcgcaggaagggctgagcaatcctgagggaagtaaaaaatatgattga

DBGET integrated database retrieval system