KEGG   Rahnella aquatilis HX2: Q7S_24366Help
Entry
Q7S_24366         CDS       T01850                                 

Definition
(GenBank) aldehyde dehydrogenase A
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00620  Pyruvate metabolism
raa00630  Glyoxylate and dicarboxylate metabolism
raa01100  Metabolic pathways
raa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:raa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Q7S_24366
   00630 Glyoxylate and dicarboxylate metabolism
    Q7S_24366
Enzymes [BR:raa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     Q7S_24366
    1.2.1.22  lactaldehyde dehydrogenase
     Q7S_24366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 FlaG OmdA
Motif
Other DBs
NCBI-ProteinID: AFE61027
UniProt: H8NZK2
Position
PRA1:335758..337176
Genome map
AA seq 472 aa AA seqDB search
MYINGEFVENTGGKWIDVMNPATEQVISQIPEGSAEDARKAIDAAEAAQPGWEALPAVER
GVWLHKIADGIREREAELTETIIAEGGKTYGLAQTEVLFTADYLDYMAEWARRYEGEIIQ
SDRPNENIFVFRKAIGVTTGILPWNFPFFLIARKAAPALITGNTIVIKPSEITPNNAVIF
AEIIHKIGLPKGVLNIVTGYGPTVGQELAANPKVGMVSLTGSVAAGIATMTAAAQNVTKV
SLELGGKAPAIVMNDADLDLAVKAIVSSRVINTGQVCNCAERVYVQEGVYDEFISRISEA
MKKVTFGNTAEQKELDMGPLISAAALQRVEDKVAKAVSQGAKVLLGGKRHGDKGFFYQPT
VLVDVKQHMPIMHEEVFGPVLPVATFKTLDEAIAMANDSEYGLTSSIYTSNINTAMKALK
QLKFGETYINRENFEAMQGFHAGWRKSGVGGADGKHGLQEYLQTHVAYLQFH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtacatcaacggcgagttcgttgaaaacaccggcggtaagtggatcgacgttatgaac
ccggcgacagaacaggtgatttcgcagatccctgaaggctcagcagaagacgccagaaaa
gccattgatgcagcagaagcggcgcagccgggctgggaagcgttacctgcggtagagcgc
ggcgtgtggctgcataaaattgccgacggtattcgtgagcgcgaagccgaactgacggaa
accattattgcggaaggcggcaaaacctacggcctggcgcaaaccgaagtactgttcacc
gccgactaccttgattacatggcggaatgggcacgccgttacgaaggcgaaatcattcag
agtgaccggccaaatgaaaacatctttgtgttccgcaaagccatcggcgtgaccaccggt
attctgccgtggaacttcccgttcttcctgatcgcccgtaaagccgccccggcgctgatc
accggcaataccatcgtcatcaaaccgagtgaaatcacgccaaacaacgcggtgattttc
gcggaaattattcacaaaattggcctgccaaaaggtgtgctgaatattgtcaccggctac
ggcccgaccgtcgggcaggaactggcggcgaatcctaaagtcggcatggtcagtctgacc
gggagcgtggctgcaggtatcgccaccatgactgcggcggcacagaacgtcactaaagtc
tcactggaactgggcggtaaagcaccagccatcgtgatgaatgacgccgatttggatctg
gcggtgaaagccatcgtgagctcgcgcgtcatcaataccgggcaggtgtgtaactgcgcg
gagcgtgtttacgtgcaggaaggcgtatacgacgaattcatttcgcgcatcagcgaagcg
atgaaaaaagtaacgttcggcaataccgccgagcaaaaagagctggatatggggccgctg
atcagcgcggcggcattgcagcgtgtggaagataaagtggcgaaagccgtgtcacagggc
gcaaaagtgctgctgggcggcaaacgtcatggcgacaaaggtttcttctatcagccgacg
gtgctggtggatgtgaagcagcacatgccgatcatgcatgaagaagtgtttggtccggtg
ctgccggtcgccacgttcaaaacgctggatgaggcgattgccatggcaaacgacagcgaa
tatggcctgacgtcatcgatttacaccagcaatataaatacggcgatgaaagcgctgaaa
cagctgaaattcggcgagacttacatcaaccgtgaaaacttcgaagccatgcagggcttc
catgcgggctggcgtaagtcgggcgtcggtggtgccgacggtaaacatggcttgcaggaa
tatctgcaaacgcatgtcgcgtacctgcagttccattaa

DBGET integrated database retrieval system