KEGG   Rahnella aquatilis HX2: Q7S_25121
Entry
Q7S_25121         CDS       T01850                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
raa  Rahnella aquatilis HX2
Brite
KEGG Orthology (KO) [BR:raa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raa02044]
    Q7S_25121
Secretion system [BR:raa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Q7S_25121
SSDB
Motif
Pfam: T6SS_VipA ABATE
Other DBs
NCBI-ProteinID: AFE61174
UniProt: H8P0Q3
Position
PRA1:501490..501969
AA seq 159 aa
MSNTQYKLSKARPPRVQITYDVEVGGAESKKELPLVMGVIGNFAKDDLPLRDRRFTHIDK
DNFNNVMEGMKPAVDMLVESTLPEKEGQMAIALEFNSMDDFSPENVAMQVEPLRKLLELR
EQLSDLRNRTASNDRLKEQLVELLEGMAKDAEPAKGEVE
NT seq 480 nt   +upstreamnt  +downstreamnt
gtgagtaatacacaatataaattgagcaaagcgcgtccccctcgcgttcaaattacgtac
gacgttgaagttggcggtgctgaatccaaaaaagaattacctctggtgatgggggttatc
gggaattttgctaaagatgatttgccactgcgcgaccgtcgttttacgcacattgataaa
gacaactttaataatgtcatggaaggaatgaagccggctgtggacatgctggtggaaagt
acgttgccagaaaaagaaggccagatggctattgcactggaattcaactctatggatgac
ttctctcctgaaaacgtggcgatgcaggtggaaccgttgcgcaaacttcttgaattacgc
gagcaactgagtgatttgcgcaacagaactgcgagcaatgaccgtctgaaagagcaactg
gttgaattattagagggtatggcgaaagacgcagaacctgccaaaggggaagtagaatga

DBGET integrated database retrieval system