KEGG   Rahnella aquatilis HX2: Q7S_25186Help
Entry
Q7S_25186         CDS       T01850                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
raa  Rahnella aquatilis HX2
Pathway
raa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:raa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Q7S_25186
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raa02044]
    Q7S_25186
Secretion system [BR:raa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Q7S_25186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N
Motif
Other DBs
NCBI-ProteinID: AFE61187
UniProt: H8P0R6
Position
PRA1:513583..517020
Genome map
AA seq 1145 aa AA seqDB search
MFKKLLSFVAWTLFLCLLLIVCIVMSVVFEQTLLHALILWLILILAVLFSRFVWGSVSGM
AQAKYISSLKARFKLTRLEYVLFEHWKTGAAVIKRIRRRKQPIPWFILTGGRSGKTTLMA
GAGLPLFSNEPESSLVVPTRTLRWWFFRSAGFLDLSSHFLNKTPAFERGWLRLVNRCARL
PAPGGIVVCVSVSELLEKDDAELHLHARHIRTQIEPLVSKVKRRLPVYLFITCCDRVPGF
SHWANNLSAEQRQQPLGYYWRRSPVVDGKDPALLDPLFTCVKDGLDKVRVSMLSGGEPDG
DTLALMDFPEQLPKLQPALQRYLAALCEPDAYFQPAALGGIWFPATEPVSKNSASRQAFF
IHDLMARLLPELSRQREIEPVGFGRRYLHKWGAMTFSVLAITYVLFSGYFTNRLTGGSPA
QMDVTAQVQQLENIEHWNAHPLKYLPFVPVLNHRHTQLEASILAASPRDKVNLREIADNY
QQLFTDADPQQKRELILNLASTLITKQAMWEKQPVSELIKQAPVPAALSMTGATVSLPYQ
QDVVLQRALLQLPEGGKQLVVLRELLGRLVNSDPQMAWLVAPSGDLTPVNLTDFMPSSED
QTQVSGLWTLQGTAQIQGWLKEIRRAGGEQVPMPALVAFEQHWPALRQTQWMTMMLAMNQ
QPAPELTSEEWQTALITLDQGNSPSMKFSRYVNEQLEDIRAQDAEPWLRELRRLNQLQAM
SVPGALIPRISKVQQSFQKKISALLKIDSKTLTPVLSDLNVKNWNAWKNSLHAAVSDVFA
TPKSSDRLTRGLFQTGAAGDSNPLQLLDSRFNVLRKNLSAERDDFASNAVWALYQNDAHW
LVAHAMQRSACWLEQQWQSRVLWPMENNASRLEYDDQQDLAWQYLSDFIRGPAKSVLVVE
DNGPKAGEFNGQTPGLTPEFLRMVNHVLRPDDVLAMPERENTRNDDALAALKDEQADLEA
QMAALEAKPLELTLKSLPATIPGGARLMPVGTQLTLFCDEQQWKLNSMNFSEQAAFRWRP
GHCSRATLVIKFPGFDLTYEYFGDAAWPDFLQDISDGQHRFKAEDFPDDAAQLTALGIKE
VMVRYQSGSQNAVQDRWHQWQELNQALNDNAEAQQETGLKKAEKQRPTALKSAFSQLPVR
ITGCH
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaattactttcctttgtcgcatggacactatttctgtgcctgttacttatt
gtttgtattgtcatgtctgttgttttcgaacaaacactcctgcatgcattaattttgtgg
ctgatattgatcctcgccgttttattttcccggtttgtctggggatctgtttccggtatg
gcgcaggcgaaatatatctcctccctgaaggcaagatttaaactcacccggctggaatat
gttttattcgaacactggaaaaccggggctgcggtaattaagcgcatcagaagacgcaaa
cagccaataccctggtttatactcactggcgggcgaagtggtaaaacgacgctgatggcc
ggtgcaggattaccgctgttttctaatgaaccggaaagttctctggttgtgccgacccgc
accttacgctggtggttttttcgttccgcaggttttctcgacctctccagccattttctg
aataaaaccccggccttcgagcgcggctggttgcgtctggtgaaccggtgtgcccgtctg
cctgcgccgggtggcatcgtggtgtgcgtgtcggtcagtgagttgctcgaaaaagatgac
gcggaactgcatctgcatgcgcggcatatccgcacgcagatcgaaccgctggtcagtaaa
gtcaaacgccgtctgccggtgtatctgtttatcacttgttgtgaccgggtgcccggtttc
agccactgggccaataatctctccgccgaacagcgccagcaaccgctgggttactactgg
cgccgttcgcctgtcgtcgacgggaaagatccggccttgctggatccgctgtttacgtgc
gtgaaagacgggctggataaagtgcgtgtcagcatgctttcgggcggcgaaccggatggc
gacacgctggcgttgatggatttccctgaacagctaccgaaattgcaacctgcactgcaa
cgttatctggccgccctgtgtgagccggacgcttactttcagcccgcagcactgggtggt
atctggtttcccgccactgaacctgtcagcaaaaacagtgcttcgcgtcaggctttcttt
atccatgacctgatggcccgattactgcctgaactaagccgccagcgtgaaattgagcct
gtcgggtttggccgtcgctatctgcataaatggggggcgatgaccttcagtgtgctggca
ataacctatgtgctgttttccggttatttcaccaaccgcctcaccgggggctcgcccgcg
caaatggatgtcacggcgcaggttcagcagcttgagaacattgaacactggaatgcacat
ccgctgaaatatttaccttttgttcccgttctcaaccatcgccatacgcagcttgaggcc
agcattcttgctgcatccccacgcgataaggtgaacctgcgggagatagcagataactac
cagcagctgttcaccgacgccgatccacagcaaaaacgcgagttgattctgaacctggca
agcacgcttatcactaaacaggccatgtgggaaaaacagccggtcagtgagctgataaaa
caggcgccggttccggcggcgctgagcatgaccggggccaccgtgtccttaccctatcaa
caggatgtggtgttgcaacgcgcgctgttacagttgccggaaggcggcaagcaacttgtg
gtactgcgcgaattgctcggacgtttggtcaacagtgatccgcagatggcatggctggtg
gctccttcaggcgatctgacgccagtgaatctgacggatttcatgccctcgtctgaggat
caaacgcaggtcagtggtctgtggacgctacagggcaccgcacaaattcagggctggttg
aaggaaatccgtcgcgcaggaggtgaacaggtcccgatgcctgcgctagtggcttttgaa
cagcactggcctgcgctgcgccagacgcaatggatgacgatgatgctggcgatgaaccag
caacccgccccggagctgaccagcgaagagtggcaaaccgcgctgattacgctcgatcag
ggtaacagcccatcaatgaaattttcccgttacgtcaatgaacaactagaagacatccgt
gctcaggatgccgagccctggttgcgcgagctgcgccggttgaatcagttacaggctatg
tcggtacccggtgcgctgataccgcgtatcagcaaggtccagcagtcttttcagaagaaa
atttcagcactgctgaaaatcgacagcaaaaccctgacacccgtgctttccgatctcaat
gtgaaaaactggaatgcctggaaaaacagtctgcatgcggcggtttcggacgtgtttgct
acgccgaaaagcagcgatcgtctgacgcgcggactgttccagaccggcgcggcgggcgac
agcaatccactgcaattactcgacagccgttttaacgtgctgcgtaagaacctgtcggcg
gaacgcgatgattttgcctccaacgcggtgtgggcgttgtatcagaatgatgcgcactgg
ctggtggcgcatgccatgcagcgttctgcctgctggcttgaacagcaatggcagagccgg
gtgctgtggccaatggaaaataatgccagccgtctggagtacgacgaccaacaggatctg
gcgtggcaatacctgtctgactttatccggggaccggcaaaaagtgtgctggtggttgaa
gataacgggccaaaagcgggcgaattcaacgggcagacaccgggcctgacaccggaattt
ctgcgaatggtcaatcacgtgttgcgtccggatgacgtgctggcgatgccggaacgtgaa
aatacccgcaatgacgatgcgctggccgccctgaaagatgagcaggccgatctggaggct
caaatggcggcactggaagcaaaaccgctggaactgacgcttaaaagcctgcctgccacc
attcccggcggtgcgcggctgatgccggtgggcactcagttgacgctgttctgcgatgag
caacagtggaagctcaatagcatgaacttcagcgaacaggcggcattccgctggcgtccg
gggcattgcagtcgtgccacgctggtgatcaagttccctggtttcgatctgacgtacgaa
tacttcggcgacgccgcatggcctgatttcctgcaggacatttccgacgggcagcatcgt
ttcaaagcggaagatttcccggatgatgccgctcagctgacggcactgggcatcaaagaa
gtcatggtgcgttatcagagcggctcacagaacgcggtgcaggatcgctggcatcagtgg
caggaactcaatcaggcactgaatgacaacgctgaggcgcagcaggaaaccggccttaaa
aaagcggaaaaacaacgaccgacagcgctgaaaagtgcgttctcgcaactgcctgtccgc
attaccggatgtcactga

DBGET integrated database retrieval system