KEGG   Rickettsia amblyommatis Ac37: AL573_01440Help
Entry
AL573_01440       CDS       T04237                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
rab  Rickettsia amblyommatis Ac37
Pathway
rab00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rab00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AL573_01440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rab01007]
    AL573_01440
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rab03016]
    AL573_01440
   03029 Mitochondrial biogenesis [BR:rab03029]
    AL573_01440
Enzymes [BR:rab01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     AL573_01440
Amino acid related enzymes [BR:rab01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   AL573_01440
Transfer RNA biogenesis [BR:rab03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AL573_01440
 Prokaryotic type
   Other AARSs
    AL573_01440
Mitochondrial biogenesis [BR:rab03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AL573_01440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon
Motif
Other DBs
NCBI-ProteinID: ALA61459
Position
277002..278810
Genome map
AA seq 602 aa AA seqDB search
MHKYRTHNCNELQISDVEQEVKLSGWVHRRRDHGNLVFIDLRDHYGITQIVFTDQNPQLM
EDASRLRYESVITVRGTVVARSEDTINNTLPTGHVEVLAVEFSVESAADTLPFVINTEKD
APEESRLKHRFLDLRREKLHNNIILRSQIISHIRHLMTASGFTEFQTPILTASSPEGARD
FLVPSRMHPGKFYALPQAPQQFKQLLMVSGFDRYFQIAPCFRDEDARADRSPGEFYQLDV
EMSFVTQEDVFSTIEPVMYDLFTKFTDKKVSETPFVCIPYNESMLKYGSDKPDLRNPIII
ADVTEIFRDSDFTIFRENIKKGSIVRAIPAPKAAVLPRSFFDKMIEFAISEGAGGLGYIQ
FSETGEAKGPVVKFLSLQQLESLKATASISNGDAVFFASDKKEKAAKLAGKIRVRLGEEL
DLLEKDCFKFCWITDFPFYELNEETGKIDFSHNPFSMPQGGIDALEQAKTIEELLELTAY
QYDIVCNGIELSSGAIRNHKPEIMYKAFSIAGYSEEEVDKRFGGMIRAFKFGAPPHGGIA
PGIDRIVMLLAEATNIREIIAFPLNQQAEDLLMNAPSYVEDKALKELSIMLSPSARKNAE
KE
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcataaatacagaactcataattgtaacgaattacaaatatccgatgtagaacaagaa
gttaagctatccggttgggtacatagaagaagagatcacgggaatctagtttttatagat
ttacgtgatcattacggtataactcaaatcgtgtttaccgatcaaaaccctcagcttatg
gaggatgcaagtcgtttgcgttatgagtcagtaattacggtaaggggtacagttgtagca
agatcagaggacacgattaataatacgcttccgacaggtcatgttgaagtactagctgtg
gaatttagtgttgagtcagctgcggacactctaccttttgttattaataccgaaaaagac
gctcccgaagagtctaggcttaaacatcgctttttagatcttagacgtgagaaattacat
aataatataatactccgctcacaaattatttctcatattcgtcatttgatgacggcaagc
ggttttaccgaatttcaaactccgattttaacagcaagctcacctgagggggctagggat
tttttagtaccgagtagaatgcatccgggtaagttctatgcattaccgcaagcacctcag
caattcaagcagttattgatggtatcaggctttgatcgttatttccaaattgctccttgt
tttcgggatgaagatgcaagagccgatagatcacccggcgagttttatcagctagatgta
gaaatgtcgtttgttacacaggaagacgtatttagtactattgagcctgtgatgtatgat
ttattcactaaattcacggataagaaagtatcagagactcctttcgtttgtattccatat
aatgaatctatgctaaaatacggctctgataagcctgatttgcgtaaccctattataatt
gccgatgtaactgagatatttagagattccgattttacaatctttagagagaatattaaa
aaaggtagcatagttcgtgcaattcctgcacctaaggcagctgtactgcctcgtagtttc
ttcgataaaatgatagagtttgcgatatcagaaggagcaggtggacttggctatattcag
tttagtgaaaccggtgaagcaaaaggaccggtagtaaaattcttaagcctgcagcaatta
gagagtctaaaagctacagctagtattagtaatggtgatgctgtattttttgctagcgat
aagaaagagaaagctgctaaacttgccggtaagattagagtaagacttggtgaagagctt
gatttacttgaaaaagattgttttaaattctgctggattaccgattttccattctatgag
ttaaatgaagaaacaggaaaaattgattttagccataatccgttttctatgccgcagggc
ggcatagatgctttagagcaagctaaaaccattgaagagttattagaacttaccgcatac
caatatgatattgtttgtaacggtattgaactttccagcggtgctattagaaaccataag
ccggaaattatgtataaagcattttccatagcaggttatagtgaagaggaagttgataag
agatttggagggatgattagagcatttaagtttggagctccaccacatggtggaatagcc
cccggtattgaccgaatcgttatgctgcttgcggaagcaacaaatataagggaaataatt
gcgtttcctttaaaccagcaggctgaagatttgctaatgaacgccccaagctatgtagag
gataaagctctaaaagagctaagtatcatgctctcaccgtctgctagaaaaaatgcagaa
aaagaataa

DBGET integrated database retrieval system