KEGG   Rickettsia amblyommatis Ac37: AL573_03575Help
Entry
AL573_03575       CDS       T04237                                 

Definition
(GenBank) succinate--CoA ligase
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
rab  Rickettsia amblyommatis Ac37
Pathway
rab00020  Citrate cycle (TCA cycle)
rab00640  Propanoate metabolism
rab01100  Metabolic pathways
rab01110  Biosynthesis of secondary metabolites
rab01120  Microbial metabolism in diverse environments
rab01130  Biosynthesis of antibiotics
rab01200  Carbon metabolism
Module
rab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AL573_03575
   00640 Propanoate metabolism
    AL573_03575
   00660 C5-Branched dibasic acid metabolism
    AL573_03575
Enzymes [BR:rab01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AL573_03575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ALA61776
Position
complement(676868..677746)
Genome map
AA seq 292 aa AA seqDB search
MAILINKKTQVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEA
KAKTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRALVGSKTRLI
GPNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGG
DPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITA
PPGKRMGHAGAIITGGTGSAEDKLEALQSAGVTITRSPADIGKTMLDLLNKG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcaatattaataaataaaaaaacacaagttatctgtcagggttttactggttcacaa
ggaacttttcactctgaacaagcgatagcgtacggcactaacatggttggcggtgttaca
cccggcaaaggcggtcatactcaccttgatttacctgtatataataccgtacatgaagca
aaagcaaaaaccggtgcaaatgcaagcgttatatatgttccgcccggctttgccgctgat
tcgatattagaagcaatcgatgccgaaattgaagtagtagtatgtataacggaaggaatt
ccggtgcttgatatggtgaaagtaaaacgcgctttagtcggttctaaaactagattaatc
ggtcctaactgccctggagttatcacaccgggtgaatgtaaaatcggtattatgcctggg
catattcataaaagaggaactataggtattgtttcaagatcaggtactctaacttatgaa
gcagtagcgcagacaacagcagtaggacttggacaatctacgtgtgtcggtataggtggc
gatcctgttaacggcactaattttgttgattgtattgagatgtttttgaaagatgatgaa
acaaaagcaattattatgatcggtgaaattggcggtaatgcagaagaagatgcagctgag
tttatcaagcagtcaaaaatcaagaaacctatagtaagctttattgcaggtattacagca
cctccaggtaaaagaatgggacatgccggagctattattaccggaggaacaggaagtgcc
gaagataagcttgaagcgctacaaagtgccggcgtaactatcactagatcccctgccgat
atcggcaaaactatgttggatttactcaataaaggctaa

DBGET integrated database retrieval system