KEGG   Rickettsia amblyommatis Ac37: AL573_06595Help
Entry
AL573_06595       CDS       T04237                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rab  Rickettsia amblyommatis Ac37
Pathway
rab00071  Fatty acid degradation
rab00072  Synthesis and degradation of ketone bodies
rab00280  Valine, leucine and isoleucine degradation
rab00310  Lysine degradation
rab00362  Benzoate degradation
rab00380  Tryptophan metabolism
rab00620  Pyruvate metabolism
rab00630  Glyoxylate and dicarboxylate metabolism
rab00640  Propanoate metabolism
rab00650  Butanoate metabolism
rab00900  Terpenoid backbone biosynthesis
rab01100  Metabolic pathways
rab01110  Biosynthesis of secondary metabolites
rab01120  Microbial metabolism in diverse environments
rab01130  Biosynthesis of antibiotics
rab01200  Carbon metabolism
rab01212  Fatty acid metabolism
rab02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL573_06595
   00630 Glyoxylate and dicarboxylate metabolism
    AL573_06595
   00640 Propanoate metabolism
    AL573_06595
   00650 Butanoate metabolism
    AL573_06595
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AL573_06595
   00072 Synthesis and degradation of ketone bodies
    AL573_06595
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AL573_06595
   00310 Lysine degradation
    AL573_06595
   00380 Tryptophan metabolism
    AL573_06595
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AL573_06595
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AL573_06595
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL573_06595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rab04147]
    AL573_06595
Enzymes [BR:rab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AL573_06595
Exosome [BR:rab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AL573_06595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALA62185
Position
complement(1269848..1271026)
Genome map
AA seq 392 aa AA seqDB search
MTKPVYITYAKRTAFGSFMGSLSTTAAPMLAAHLIKDILQNSKIDPALVGEVILGQVITG
GSGQNPARQTLIYAGIPKEVPGYTINKVCGSGLKSVALAANSIMTGDSEIVIAGGQENMS
LGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAENISKQFNISRQQQDEFAL
SSHKKAAKAQLAGVFKDEILPIEVTIKKTTSLFDHDETVRPDTSLKILSKLRPAFDKNGV
VTVGNASSINDGAACLMVVSEEALKKHNLTPLARIVSYASAGVDPNIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDMEKVNINGGAIAIGHPIGASGGRVLIT
LIHGLLRAKAKKGLVTLCIGGGMGMAMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaccggtttatataacttatgcgaaaaggactgctttcggctcgtttatgggt
agccttagtacaacagctgcacctatgcttgctgctcatttaataaaggatatactgcaa
aacagcaaaatcgatccagctttagtaggtgaggtaatccttggacaggtaataaccggc
ggtagcgggcagaatccggcgaggcaaactctgatttatgcgggaataccgaaagaagtg
ccgggctatacgattaataaagtatgcggctcaggtcttaaaagcgtagcacttgcagca
aattcaattatgacgggtgatagtgaaatagttatagcaggtgggcaggagaatatgtcg
ctcggtatgcacggtagctatatcagagcaggagctaaatttggtgatattaaaatggtt
gatctaatgcagtatgacggattaaccgatgtattttcaggagtatttatgggtattact
gccgaaaatatctcgaaacagtttaatattagcagacaacagcaggacgagtttgcctta
agctctcacaagaaagcagctaaagcacagttagcaggagtttttaaagatgaaatctta
cctatcgaagtaacgattaaaaaaactactagtttgtttgatcatgatgaaacagtaaga
cctgataccagccttaaaattttgagtaaattacgtcctgcttttgataaaaacggtgta
gttacggtgggtaatgcttcctctattaatgacggtgcggcatgtcttatggtagtttcc
gaagaagctttgaaaaagcataatttaacgccgctagctcgtattgtttcttatgcttca
gccggtgttgatccaaatattatgggtactgcccctgtgcctgcatccaaaaaagcttta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcgtttgcc
gctcaaagtatttatgtaaaccgtgaaatgaaatgggatatggagaaggttaatattaac
ggtggagcaatagcaatcggtcatccgatcggggcaagcggcggacgtgtacttattact
ctgatacacggcttattaagagctaaagctaaaaaaggcttagttactctatgtatcggt
ggtggtatgggtatggctatgtgcgttgaagcggtttaa

DBGET integrated database retrieval system