KEGG   Rhodoferax antarcticus: RA876_03150Help
Entry
RA876_03150       CDS       T04655                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rac  Rhodoferax antarcticus
Pathway
rac00260  Glycine, serine and threonine metabolism
rac01100  Metabolic pathways
rac01110  Biosynthesis of secondary metabolites
rac01120  Microbial metabolism in diverse environments
rac01130  Biosynthesis of antibiotics
rac01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RA876_03150
Enzymes [BR:rac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     RA876_03150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: APW48174
Position
complement(650174..651385)
Genome map
AA seq 403 aa AA seqDB search
MKIVDLRSDTVTQPTAAMRAVIAAAPVGDDVFGDDPSVNALQDQLAAMLGFEAALFVPTG
TQSNLCALMAHCQRGDEYIVGQMAHTYRWEGGGAAVLGSIQPQPLAHQDDGTLALQDIEA
AIKPDDAHFAKTRLLTLENTLGGKLLPFDYVQAATDLARQHGLGRHLDGARLFNAAVAQA
VQLVAKNVSNQSSTLIERAQVAIHSDDFAKRSATLQAAPVAALKDPAKALNVAALHSQAA
IVAEARRIAQCFDSVSVCLSKGLGAPVGSVLCGNADLIARAHRIRKMAGGGMRQAGMLAA
AGSYALGHHLTRLANDHALAARLAAGLQGLPGVLVEPPQTNMVFIDVVGEAKAKAPGLLA
YLKSHGVLATGLYRLRFVTHLDVDAAGIDRAVTLVRTFFEDKA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgtcgacctgcgcagcgacaccgtcacccaacccaccgccgccatgcgcgcc
gtgatagctgccgccccggtcggtgacgatgtgtttggcgacgaccccagcgtcaacgcc
ctgcaagaccagctggcagccatgctgggttttgaggcagcgctgtttgtgcccaccggc
acgcaaagcaacctgtgcgcgctgatggcgcattgccagcgcggtgacgagtacatcgtc
ggccagatggcgcacacctaccgctgggaaggtggcggcgcagcggtgctgggcagcatc
caaccgcagccgctggcccatcaggacgacggcacgctggcgctgcaagacatcgaagcc
gccattaagcctgacgacgcgcactttgccaaaacccggctgctgacgctggaaaacacc
ttgggcggcaagctgctgccgtttgactatgtgcaagccgccaccgatctggcgcgccaa
cacgggctggggcggcatctggacggcgcacggctgttcaacgcagcggtggcgcaggcc
gtgcaactcgttgcaaaaaatgtatcaaatcagtcttcaacccttattgaacgtgcgcag
gtagctattcattctgatgatttcgcaaaacgaagtgcaacacttcaagcagccccggta
gctgcactaaaagacccagccaaggcgctcaacgtcgccgccttgcacagccaagccgcc
atcgtcgctgaagcgcgccgcatcgcccaatgctttgacagcgtgtcggtgtgtctgagc
aaaggcttgggcgcgccggtgggttcggtgctgtgtggcaacgcagacctgatcgcccgc
gcacaccgcatccgcaagatggccggtggcggcatgcgtcaggccggcatgctggccgcg
gccggcagctacgcgttagggcatcacctcacccgtttggccaacgaccatgcgctggcg
gcgcggctagccgctggcctgcaaggcctgcccggcgtgctggtggagccgccacaaacc
aacatggtgttcattgatgtcgtcggtgaagccaaggccaaagcgcctgggctgctcgcc
tatttgaagtctcacggcgtgctggccaccggcttgtaccggctgcgctttgtcacccac
ctcgatgtagacgccgccggcattgaccgcgcggtgaccttggtccgtaccttttttgaa
gacaaggcctga

DBGET integrated database retrieval system