KEGG   Rhodoferax antarcticus: RA876_03275Help
Entry
RA876_03275       CDS       T04655                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
rac  Rhodoferax antarcticus
Brite
KEGG Orthology (KO) [BR:rac00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    RA876_03275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF11
Motif
Other DBs
NCBI-ProteinID: APW45552
Position
complement(684516..684911)
Genome map
AA seq 131 aa AA seqDB search
MPKPPTYQFHVQVKPRYQPQRSDPAQAIYFFTYTITVRNTGTLAAQLISRTWNVNDADGH
HEKVKGLGVVGRQPLLQPGEAFEYTSGTRLQTPTGTMHGSYFCVAEDGEKFDVDVPMFVL
DALSASAGQRD
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaccacccacttatcagttccacgttcaggtcaagccgcgttaccagccacag
cggtctgaccctgcgcaggcgatctattttttcacctacaccatcacggtgcgcaacact
ggcacgctggcggcgcagctgatctcgcgcacctggaacgtcaacgacgccgacggccac
cacgaaaaggtcaagggcctgggcgtggttgggcgccagccgctgctacagcccggcgaa
gcgtttgagtacaccagcggcacccgcttgcagacacctaccggcaccatgcacggcagt
tatttctgcgtggccgaagacggcgaaaagttcgatgtggatgtgcccatgtttgtgctg
gacgccctgagcgccagcgcgggccaacgggactga

DBGET integrated database retrieval system