KEGG   Rhodoferax antarcticus: RA876_04065Help
Entry
RA876_04065       CDS       T04655                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rac  Rhodoferax antarcticus
Pathway
rac00071  Fatty acid degradation
rac00072  Synthesis and degradation of ketone bodies
rac00280  Valine, leucine and isoleucine degradation
rac00310  Lysine degradation
rac00362  Benzoate degradation
rac00380  Tryptophan metabolism
rac00620  Pyruvate metabolism
rac00630  Glyoxylate and dicarboxylate metabolism
rac00640  Propanoate metabolism
rac00650  Butanoate metabolism
rac00900  Terpenoid backbone biosynthesis
rac01100  Metabolic pathways
rac01110  Biosynthesis of secondary metabolites
rac01120  Microbial metabolism in diverse environments
rac01130  Biosynthesis of antibiotics
rac01200  Carbon metabolism
rac01212  Fatty acid metabolism
rac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rac00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RA876_04065
   00630 Glyoxylate and dicarboxylate metabolism
    RA876_04065
   00640 Propanoate metabolism
    RA876_04065
   00650 Butanoate metabolism
    RA876_04065
  Lipid metabolism
   00071 Fatty acid degradation
    RA876_04065
   00072 Synthesis and degradation of ketone bodies
    RA876_04065
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RA876_04065
   00310 Lysine degradation
    RA876_04065
   00380 Tryptophan metabolism
    RA876_04065
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RA876_04065
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RA876_04065
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RA876_04065
Enzymes [BR:rac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RA876_04065
Exosome [BR:rac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RA876_04065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: APW45679
Position
840417..841598
Genome map
AA seq 393 aa AA seqDB search
MTDSIVIVGAARTPLGSFQGDFSALAAHDLGAAAIRAAIERSGVSPDAVDEVLFGNVLPA
GQGQAPARQAALKAGLPISAGAVTLSKICGSGMRSAMFGHDMLLAGSADVLVVGGMESMT
NAPYLLPKARAGHRIGHDRILDHMMLDGLEDAYEAGRSMGTFGEDCAAKFGFTREQQDAY
AIESVTRAQNAINSGAFAAEITPVTVKARAGDKVISIDEGPGRIRLDKIPTLKPAFKKDG
TITAASSSSINDGAAALVLMRESTAVKLGCKPLARIVAHAVHAQEPAWFATAPVGSVRKV
LARAGWSVNDVDLWEVNEAFAVVAMALMHDLNLSHDIVNVNGGACALGHPIGASGARIMV
TLIYALQAHGLKKGVATLCIGGGEATAIALEML
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccatcgtgatcgtcggcgcggcccgcacccccttgggcagttttcagggg
gacttttccgcgctggccgcgcatgacctgggcgctgccgccatccgcgccgccatcgag
cgctcaggcgtttcgcctgacgcagtggacgaagtgctgtttggcaatgtgctcccagcc
ggccagggccaagcgccggcgcgccaggccgcgctcaaggcaggtttgcccatcagcgca
ggcgcggtcaccctgtccaaaatctgcggttcgggcatgcgcagcgccatgtttggccat
gacatgctgctggcaggcagcgccgatgtgctggtcgtcggcggcatggagagcatgacc
aacgcgccctacttgctgcccaaagcgcgcgctggccaccgcatcggccatgaccgcatc
cttgaccacatgatgcttgacggcctggaagacgcctatgaagcggggcgctcaatgggc
acctttggcgaagactgcgccgccaaattcggctttacccgtgagcagcaagatgcctac
gccattgagagcgtgacccgtgcgcaaaacgccatcaactcgggtgcgtttgccgccgag
atcaccccggtcacggtcaaggcccgcgctggggataaggtcatcagcattgacgaaggc
ccaggccgcatcaggctcgacaagatccccacgctcaaacccgcgttcaagaaagacggc
accattaccgccgccagcagctccagcatcaacgacggcgccgccgcgctggtgctgatg
cgcgaatcgacagcggtgaaactcggttgcaaaccgctggcgcgcatcgtggcgcatgcg
gtgcacgcccaagagccggcctggtttgccactgcgccggtcgggtcggtacgtaaagtg
ctggcgcgtgcgggttggagcgtgaatgatgtggacctgtgggaggtgaacgaagccttt
gccgtagtggccatggcgctgatgcacgacctgaacctgagccacgacatcgtcaacgtg
aacggcggcgcctgcgccctgggccacccgattggtgccagcggcgcgcgcatcatggtc
acgctgatatacgccttgcaggcgcatgggctgaaaaaaggtgttgctaccctgtgtatt
ggcggtggcgaggcgacagccattgcgctggagatgctctga

DBGET integrated database retrieval system