KEGG   Rhodoferax antarcticus: RA876_06125Help
Entry
RA876_06125       CDS       T04655                                 

Definition
(GenBank) ferredoxin:protochlorophyllide reductase (ATP-dependent) subunit B
  KO
K04039  light-independent protochlorophyllide reductase subunit B [EC:1.3.7.7]
Organism
rac  Rhodoferax antarcticus
Pathway
rac00860  Porphyrin and chlorophyll metabolism
rac01100  Metabolic pathways
rac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RA876_06125
Enzymes [BR:rac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     RA876_06125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro PCP_red
Motif
Other DBs
NCBI-ProteinID: APW46021
Position
complement(1257549..1259123)
Genome map
AA seq 524 aa AA seqDB search
MQLTLWTYEGPPHVGAMRVATAMTDIHYVLHAPQGDTYADLLFTMIERLPRRPPVTYTTF
QARDLGGDTAQLFKDAVASAFDRFKPRAVLVGSSCTAELIQDDPGGLALALGLPVPVIPL
ELPAYQRKENWGASETFYQLARHLVKPPDKSAAATPHKPCCNILGPTALGFRHRDDVREI
SQLLQALGVEVAVTAPWAASVEDLQNLARADFNVVLYPEVAHTTALWLERQFNQPYTRVM
PIGVSATREFIQEVATLAGVEIPPDLEKNARSVWFSRSVDSTYLTGKRVFLFGDASHVVA
AARFATEEMGFEVVGMGTYSREFAREVRDAAKKYNVEPLITDDYLLVEEQIKNLHPELIL
GTQMERHIAKRQGIPCAVISAPVHIQDYPARYAPQMGFEGANVLFDTWVHPLMMGLEEHL
LGMFREDFEFHDGVAPSHLGSVRAQPTEAPPPQKSVSDQILVPSTAVAPITATAWSTDAE
KELGKIPFFVRGKARRNTERFAMEHGLSTITVETLYDAKAHYSR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttaccctctggacttacgaaggcccacctcacgtgggcgcaatgcgtgtggcg
acggccatgacggatattcactatgtgctgcatgcgccgcaaggcgatacgtatgcggat
ctgttattcaccatgattgagcgcttgcccaggcggccgccggtgacctacaccactttt
caggccagggatctgggtggtgacacagcgcagctgttcaaagacgccgtggcaagtgct
tttgatcgatttaagccacgggcagtcttggttgggtcctcttgcacggccgagctcatt
caggatgatcccggtgggcttgccctggcgctgggtttgccagtgccggtgattcccctg
gagttgcctgcctaccagcgtaaagaaaactggggcgcttcagagactttttaccaactc
gccaggcatttggtgaagccaccagacaagagcgcggccgcaacaccgcacaagccctgc
tgcaatattttgggccctaccgcacttggtttcagacaccgagacgacgtgcgcgaaatc
tctcagctcttgcaggcattaggcgtagaagttgcagtgacagcgccttgggctgcgtcg
gtagaggatcttcagaatttggcccgtgccgacttcaacgttgtcctgtatccggaagtg
gcacacaccactgcactctggttggagcgtcaattcaatcagccctacacccgagtgatg
cccattggggtcagcgcgacgcgtgaattcatccaagaagttgccaccttggccggtgtg
gagattccccctgacctcgaaaagaacgcccgctcggtgtggttctccagatcagttgac
tcaacttacctaactggcaaacgtgtgtttttgtttggagatgcgtcgcatgtcgttgct
gcagcccggtttgccacggaagaaatggggtttgaagttgttggcatgggcacgtacagc
cgggagtttgcacgtgaagtcagggatgcagccaagaagtacaacgttgagccgctgatc
accgatgactatttgttggtggaagagcaaatcaagaaccttcaccctgagttgattttg
ggcactcagatggagcgccatattgccaaaagacagggaatcccttgtgcggtgatctct
gcacctgtgcatatccaagactatccggcgcgttacgcgcctcagatgggtttcgagggt
gccaatgttttattcgacacatgggtgcacccgctgatgatggggctggaagagcatttg
ctgggcatgttccgggaagattttgagtttcatgatggtgtagccccatcgcacctgggc
tcggttcgtgctcaaccaacagaagcaccaccgcctcaaaaatcggtaagtgatcaaatt
ctggtcccgagcacagcggttgcaccaataactgcgaccgcctggagcacagatgctgag
aaagagcttggaaaaataccgttctttgtacgcggtaaagcacgcagaaatacggagcgt
ttcgctatggaacatggcctgagtaccattacggtggagacactatatgacgcaaaagca
cactacagccgttga

DBGET integrated database retrieval system