KEGG   Rhodoferax antarcticus: RA876_16365Help
Entry
RA876_16365       CDS       T04655                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
rac  Rhodoferax antarcticus
Pathway
rac00471  D-Glutamine and D-glutamate metabolism
rac00550  Peptidoglycan biosynthesis
rac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    RA876_16365
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RA876_16365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rac01011]
    RA876_16365
Enzymes [BR:rac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     RA876_16365
Peptidoglycan biosynthesis and degradation proteins [BR:rac01011]
 Precursor biosynthesis
  Amino acid ligase
   RA876_16365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C AlaDh_PNT_C CbiA
Motif
Other DBs
NCBI-ProteinID: APW48507
Position
complement(3368558..3370156)
Genome map
AA seq 532 aa AA seqDB search
MNTLHDQHVLILGLGASGLAMARWCTRFGARVTVADTRLAPPQLARLQSELPAARFIGGA
FDAAMVQGTDLRAVFKSPGLSPAEVAPVFEAAQAIGIWAAGELGLYSQALAALKLERGYT
PAVLAITGTNGKTTVTSLTAQLLARAGKSVAMAGNIGPTLLDTLAQHLDANSLPDVWVLE
LSSFQLDGETSFEPTAAAALNISQDHLDWHGSMAAYAQAKSNIFGKTALMVLNREDEEVM
RMLSADKPPLGAKTPSGGSAAHAMASAGATKSPVKIKGQKPQQRACILFGGDMPQRPGDF
GIETINGMTWLVRALDADETKRKRNEAAEELFFQRLMPADALRIRGRHNATNALAALALA
SSAGCALAPMLFGLREYTGEPHRVQPIGTVNAVEYFDDSKGTNVGATVAALLGLGADRKV
VAILGGEGKGQDFSPLADPVRRCVRTVVLIGRDAPLIRAALQDTGIPVLDATSMADAVRQ
ASGQAQPGDAVLMSPACASFDMFDNYEHRARVFVQAVTELALDAGVMLEGQA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccctgcatgaccaacacgtgctgatcctgggcctgggtgcgtccggcctggcg
atggcgcgttggtgcacgcgttttggcgcgcgggtcacggtggctgatacgcgtttggcc
ccaccgcagttggcccggttgcagtccgagcttcccgccgcgcgcttcattggtggcgcc
tttgacgctgcgatggtgcagggcaccgacctgcgcgcggtgttcaagagtcccggcttg
agtccggctgaggttgctcctgtttttgaagctgctcaggcaattggtatatgggctgca
ggcgaattaggcttatattcccaagctttggcagcgttaaagttagagcgtggttacacg
cctgccgtgctggccatcaccggcaccaacggtaaaacaacggtaacctcgctgaccgcg
caactgctggcgcgcgctggcaaaagtgtggcgatggccggcaatatcggcccgacactg
ctcgacaccctggcccaacatctggatgccaacagcctgccggacgtctgggtgctggag
ctttcgagcttccagttggatggcgaaaccagcttcgagccgactgccgccgcggcgctg
aacatcagccaggaccatctcgactggcatggctcaatggccgcctacgcccaagccaag
agcaacatctttggtaaaaccgctctgatggtgctcaaccgtgaagacgaagaagtcatg
cggatgttgagcgccgacaagccgcccttaggcgcgaagaccccctcggggggcagcgca
gcacatgcaatggcaagtgcgggggccacgaaatcacccgtgaagatcaagggccaaaag
ccccagcagcgcgcttgcattttgtttggtggcgatatgccgcagcgcccgggcgacttt
gggatcgagaccatcaacggcatgacctggctggtgcgcgccctggacgctgacgagacc
aaacgcaagcgcaacgaagccgctgaagaactgtttttccagcggttgatgcctgccgac
gcgctgcgcattcgtggccgccacaacgccaccaatgccttggcggccttggcgctggca
agtagcgcgggctgcgcgctagcgcccatgctctttggcctgcgcgagtacaccggcgag
ccgcaccgcgtgcagccgattggtacggtgaacgcggtggaatatttcgacgacagcaaa
ggcacgaatgtgggcgccacggtggccgcgctgctgggtctgggggctgaccgcaaggtg
gtggcaattctgggcggcgagggcaaggggcaagacttttcgccgctggctgacccggtg
cgccggtgcgtgcgcacggtggtgctgatcgggcgtgacgcacccttgatccgggctgcg
cttcaagacaccggcatccctgtgctggatgccacctcgatggctgacgctgtgcgccaa
gccagcggacaggctcagccaggcgacgcggtgctgatgtcacccgcttgcgccagtttt
gacatgttcgacaactacgaacaccgcgcccgcgtgtttgtgcaggcggtgaccgagctg
gccctggatgccggtgtgatgctggaggggcaggcatga

DBGET integrated database retrieval system