KEGG   Rhodoferax antarcticus: RA876_17745Help
Entry
RA876_17745       CDS       T04655                                 

Definition
(GenBank) class II fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
rac  Rhodoferax antarcticus
Pathway
rac00010  Glycolysis / Gluconeogenesis
rac00030  Pentose phosphate pathway
rac00051  Fructose and mannose metabolism
rac00680  Methane metabolism
rac01100  Metabolic pathways
rac01110  Biosynthesis of secondary metabolites
rac01120  Microbial metabolism in diverse environments
rac01130  Biosynthesis of antibiotics
rac01200  Carbon metabolism
rac01230  Biosynthesis of amino acids
Module
rac_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
rac_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rac_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
rac_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RA876_17745
   00030 Pentose phosphate pathway
    RA876_17745
   00051 Fructose and mannose metabolism
    RA876_17745
  09102 Energy metabolism
   00680 Methane metabolism
    RA876_17745
Enzymes [BR:rac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     RA876_17745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: APW47886
Position
complement(3656119..3657198)
Genome map
AA seq 359 aa AA seqDB search
MTQKILDVVQPGVVSGDDVQKIFAICKANQFALPAVNVISTDSINAVLEAAAKVKAPVVI
QFSNGGAGFVAGKGLKLDGQQAAILGGISGARHIHLVAESYGVPVIVHTDHAAKKLLPWI
DGLLDAGEKYFAETGKPLFSSHMLDLSEEPLKENIAICGKYLARMAKMGMTLEIELGVTG
GEEDGVDNSDRDASLLYTQPEDVAYAYEELIKISHRFTIAASFGNVHGVYKPGNVKLTPK
ILDNSQKFVSEKYKVAANTLDFVFHGGSGSSADEIKESISYGVVKMNIDTDTQWATWAGV
MAYHKKNEAYLQGQIGNPDGDDKPNKKYYDPRAWQRAGQLGMIARLEQAFEELNAVNSL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactcagaaaattctggatgtggttcagcccggtgtggtgtctggtgatgatgtgcaa
aaaatctttgccatttgtaaagccaaccaatttgcgttgcctgcggtgaacgttatcagc
accgattccatcaacgctgttttggaagctgccgccaaggtgaaggcgccggtggtgatt
cagttctccaacggcggcgcgggttttgtggcgggcaagggtttgaaacttgacggccag
caagcggctattctggggggcatttctggtgccaggcacattcacctggtggccgagtcg
tatggtgtgccggtgattgtgcataccgaccatgccgccaaaaaacttttgccgtggatt
gacggcttgctcgacgccggtgaaaaatactttgcggaaaccggcaaacccctgttcagc
tcccacatgctcgacctgtcggaagaacccctgaaggaaaacatcgccatttgcggcaaa
tacctggcccgcatggccaagatgggcatgacgctggaaatcgaactcggcgtcaccggc
ggtgaagaagacggtgtggataacagcgatcgggacgcatccctgctgtacacccagccc
gaagatgtggcctatgcctatgaagaactgatcaaaatcagccaccgtttcaccattgcc
gcttcgtttggcaatgtgcatggggtgtacaagccgggcaatgtcaaactcacaccgaag
attctggacaactcacaaaagtttgtctcggaaaaatacaaggtagcggccaacacgctg
gactttgtgttccacggcggctcgggctccagtgctgatgaaatcaaggaatccatcagc
tacggcgtggtgaagatgaacattgacaccgacacccaatgggccacatgggcgggtgtg
atggcttatcacaaaaagaacgaagcttatctgcaaggtcagatcggcaaccccgatggc
gacgacaagcccaataaaaagtattacgacccccgcgcctggcaacgtgccggtcagctc
ggcatgatcgcccgtttggagcaggccttcgaggaacttaacgccgtcaacagcctttaa

DBGET integrated database retrieval system