KEGG   Riemerella anatipestifer RA-CH-2: G148_0989Help
Entry
G148_0989         CDS       T02438                                 

Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
rae  Riemerella anatipestifer RA-CH-2
Pathway
rae00471  D-Glutamine and D-glutamate metabolism
rae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    G148_0989
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rae01011]
    G148_0989
Enzymes [BR:rae01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     G148_0989
Peptidoglycan biosynthesis and degradation proteins [BR:rae01011]
 Precursor biosynthesis
  Racemase
   G148_0989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Tn7_Tnp_TnsA_C
Motif
Other DBs
NCBI-ProteinID: AGC40293
Position
complement(1045246..1046061)
Genome map
AA seq 271 aa AA seqDB search
MLVDNLSPQQPIGVFDSGVGGLTVAKEIKRQMPHENIIYFGDTKHLPYGDKSKEAIVRFS
EKIAEFLLEQNCKAIVIACNSATANALKEVKELVGNRAIVFDVVNPVAEKIAYEIHTNVG
VIATKATVNAGIYKKSIRRFNKFIKVDELATPLLVPAIEEGFKNHPITHSILYHYLSNSK
LKNIETLILGCTHYPLLLEEIKQYYGSRVRVIDSPSIVANYIKISLEKHHLLNSEQKTTE
MKFYLSDLTKNFEKISKKFFGKSIDLELKIL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgttggtagataacctctctcctcagcaacctataggtgtgtttgattctggtgtggga
ggacttaccgtagccaaagaaatcaaaaggcaaatgccccacgaaaacatcatctatttt
ggggataccaaacatttaccttacggagataaatctaaagaagccatcgttaggttttca
gaaaaaatagccgagtttttactagagcaaaactgtaaagccatcgtaatcgcttgtaac
tctgccacggctaatgccctgaaagaagttaaagaattggtaggaaatagagcgattgtt
tttgatgtggttaatcctgttgcggagaaaatagcttatgaaatccacaccaatgtaggc
gttattgcaactaaagctaccgtaaatgctgggatttataagaaaagcatcagacgcttt
aacaaatttataaaggtagatgagctagccacaccacttttagttccagcgatagaagag
ggttttaaaaaccaccctattactcattctattttatatcattatttgagtaatagtaag
ctaaagaacattgaaacactgattttagggtgcacacattatccgctattattagaggaa
attaagcaatattatggcagtagagtaagagtgattgattcgcctagtattgtagcaaat
tacattaaaatttctttagaaaaacaccacttacttaattctgaacagaaaacaacggag
atgaagttttatctttcggatttaaccaaaaattttgaaaaaatatctaaaaagtttttt
gggaagagtatagatttagaacttaaaatactttaa

DBGET integrated database retrieval system