KEGG   Riemerella anatipestifer RA-CH-2: G148_1777Help
Entry
G148_1777         CDS       T02438                                 

Definition
(GenBank) hypothetical protein
  KO
K18221  tetracycline 11a-monooxygenase, tetracycline resistance protein [EC:1.14.13.231]
Organism
rae  Riemerella anatipestifer RA-CH-2
Pathway
rae00253  Tetracycline biosynthesis
rae01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rae00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    G148_1777
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:rae01504]
    G148_1777
Enzymes [BR:rae01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.231  tetracycline 11a-monooxygenase
     G148_1777
Antimicrobial resistance genes [BR:rae01504]
 Gene variants
  Tetracycline resistance genes
   Others
    G148_1777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Pyr_redox_2 NAD_binding_8 DAO Pyr_redox_3 NAD_binding_7 2-Hacid_dh_C Pyr_redox HI0933_like SE ApbA Shikimate_DH IlvN Thi4 NAD_Gly3P_dh_N 3HCDH_N TrkA_N NAD_binding_2 F420_oxidored Lycopene_cycl DBD_HTH 3D XdhC_C
Motif
Other DBs
NCBI-ProteinID: AGC41081
Position
complement(1863177..1864343)
Genome map
AA seq 388 aa AA seqDB search
MTMRIDTDKQMNLLSDKNVAIIGGGPVGLTMAKLLQQNGVDATVYERDKDRDARIFGGTL
DLHRDSGQEAMKRAGLLQTYYDLALPMGVNIADEKGNILTTKNVKPENRFDNPEINRNDL
RTILLNSLQNDTVIWDRKLVTLEPDKEKWTLTFEDKPSETADLVIIANGGMSKVRKFVTD
TEVEETGTFNIQADIHQPEVNCPGFFQLCNGNRLMAAHQGNLLFANPNNNGALHFGISFK
TSDEWKSKTLVDFQDRNSVVDFLLKKFSDWDERYKELIRVTSSFVGLATRIFPLGKSWKS
KRPLPITMIGDAAHLMPPFAGQGVNSGLMDALILSDNLTNGKFNSIEEAIENYEQQMFIY
GKEAQEESTQNEIEMFKPDFTFQQLLNV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgcgaatagatacagacaaacaaatgaatttacttagtgataagaacgttgca
ataattggtggtggacccgttggactgactatggcaaaattattacagcaaaacggcgtg
gacgctacagtttacgagagagacaaagaccgagatgccaggatttttggtggaacactt
gacctgcacagggattcgggacaggaagcaatgaaaagagcgggattgttacaaacttat
tatgacttagctttaccaatgggtgtaaatattgctgatgaaaagggtaatattttaacc
acaaaaaatgtaaagcccgaaaatcggtttgacaatcctgaaataaacagaaatgactta
agaactatcttattaaatagcctacaaaatgacaccgtcatttgggatagaaaacttgtt
acgcttgaacctgataaggagaagtggacactaacttttgaagataaaccgagtgaaaca
gcagatctggttattattgccaatggtggaatgtctaaagtaagaaaatttgttaccgac
acggaagttgaagaaacaggtactttcaatatacaagccgatattcatcaaccagaggtg
aactgtcctggattttttcagctatgcaatggaaaccggctaatggctgctcatcaaggt
aatttattatttgcgaatcctaataataatggtgcattgcattttggaataagttttaaa
acatctgatgaatggaaaagcaagactctggtagattttcaagacagaaatagtgtcgtt
gattttctcctgaaaaaattttccgattgggatgaacgctacaaagaactgattcgtgtg
acatcatcttttgtagggttagcgacacgaatatttcccttaggtaagtcttggaaaagt
aagcgtccattacccataacgatgattggagatgctgctcatttgatgcctccttttgca
ggacaaggcgtaaacagcgggttgatggatgccttgatattgtcggataatctgaccaat
gggaaatttaacagcattgaagaggctattgaaaattatgaacagcaaatgtttatctat
ggcaaagaagcacaagaagaatcaactcaaaacgaaattgaaatgtttaaacccgacttt
acgtttcagcaattgttaaatgtataa

DBGET integrated database retrieval system