KEGG   Rickettsia africae: RAF_ORF0158Help
Entry
RAF_ORF0158       CDS       T00979                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
raf  Rickettsia africae
Pathway
raf00020  Citrate cycle (TCA cycle)
raf00190  Oxidative phosphorylation
raf00650  Butanoate metabolism
raf01100  Metabolic pathways
raf01110  Biosynthesis of secondary metabolites
raf01120  Microbial metabolism in diverse environments
raf01130  Biosynthesis of antibiotics
raf01200  Carbon metabolism
Module
raf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
raf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
raf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:raf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RAF_ORF0158 (sdhD)
   00650 Butanoate metabolism
    RAF_ORF0158 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RAF_ORF0158 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS PAP2
Motif
Other DBs
NCBI-ProteinID: ACP53125
UniProt: C3PMG5
Position
168930..169310
Genome map
AA seq 126 aa AA seqDB search
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFMLTNKNNDINIIMLW
ELKKPFNVVALLITVVISLYHAMLGMRVVIEDYISYHKLRNTLIIIVQLFCIVTIVAFVV
VLFYKG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcaaagagtaacggggattatattagctttatgttctgtg
tggctaatatattttatgttaaccaacaaaaataatgatataaatattattatgttgtgg
gaacttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtat
catgcgatgcttggtatgcgtgtagtaattgaagattatataagttatcacaaattacgt
aatacattgattataatagtgcaattattttgcattgttactattgtagcttttgtagta
gtgctattttataaaggataa

DBGET integrated database retrieval system