KEGG   Rickettsia africae: RAF_ORF0358Help
Entry
RAF_ORF0358       CDS       T00979                                 

Gene name
virB9-1
Definition
(GenBank) VirB9
  KO
K03204  type IV secretion system protein VirB9
Organism
raf  Rickettsia africae
Pathway
raf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:raf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RAF_ORF0358 (virB9-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raf02044]
    RAF_ORF0358 (virB9-1)
Secretion system [BR:raf02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   RAF_ORF0358 (virB9-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagX
Motif
Other DBs
NCBI-ProteinID: ACP53295
UniProt: C3PMY5
Position
complement(386272..387024)
Genome map
AA seq 250 aa AA seqDB search
MKQLIIFCTFIILTLDVFALTISRPLGRDPRLRVMTYNPDDVFKFTGYYGYQASIELARD
EEIVSISMGDTTSWQIVPAGHRIFIKPMEPDATTNMTLITNKRTYFFELYAAETLDMRDP
EMVFNVKFLYPDDENDNMSGHMQTFSAALASPDLTHPEKYNFNYYISGSEEIAPIKIFDD
GEFTYLQFRDKNAEISGIFAVDDSLRESLVNYRLAQDNPNMVILEQVFPKLAIRKGKKVT
CVFNQSFKAY
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactaataatattttgtacttttataatacttacattagatgtatttgctctt
actatatcacgacctctaggtcgagacccacgtctaagagttatgacttataaccctgac
gatgttttcaaattcacaggatattacggctatcaagcaagtatagaactagcaagagac
gaggaaatagtaagtatttctatgggagatactacttcatggcaaatagtacctgccggt
cataggatttttattaaaccgatggaaccggatgctactactaatatgactttaattact
aataaacggacgtacttctttgaactatatgccgccgaaactcttgatatgcgtgatcct
gaaatggtctttaacgtaaagtttctttatccggatgacgaaaatgacaatatgagcggt
catatgcaaactttttctgctgccctagcaagtcccgacctgactcatcctgaaaaatat
aactttaattactatattagcggcagcgaagaaatagctcctattaaaatttttgatgac
ggcgagtttacttatctgcaatttagagataaaaacgctgaaatttccggtatttttgct
gtagatgattcacttcgagaatctttagtaaattatcgccttgctcaagataatcctaat
atggtgatccttgaacaggtttttcctaagctcgctatacgtaagggcaaaaaagtcaca
tgcgtatttaatcagtctttcaaagcgtattaa

DBGET integrated database retrieval system