KEGG   Rickettsia africae: RAF_ORF0361Help
Entry
RAF_ORF0361       CDS       T00979                                 

Gene name
virB8-2
Definition
(GenBank) VirB8
  KO
K03203  type IV secretion system protein VirB8
Organism
raf  Rickettsia africae
Pathway
raf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:raf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RAF_ORF0361 (virB8-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raf02044]
    RAF_ORF0361 (virB8-2)
Secretion system [BR:raf02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   RAF_ORF0361 (virB8-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8 TraE CRPA DUF3638
Motif
Other DBs
NCBI-ProteinID: ACP53298
UniProt: C3PMY8
Position
388414..389145
Genome map
AA seq 243 aa AA seqDB search
MNNIFGFFKSSNNSQSGAGDTQTQESITSANPLKITQNWYEERSDKLLVQRNLLIILIIL
LTIFMVIATLVIAFVVKSKQFEPFVIQLNSNTGRASVVEPISSPVLTADESLTRYFIKKY
ITARETYNPVDFATIARTTIRLFSTSSVYYNYLGYIRNKDFDPTLKYKEENTTFLVIKSW
SKIAADKYIVRFSVNETSGNQLVYNKIAVVSYAYVPMQLTDSELDINPVGFQVNGYRVDD
DNS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatatttggcttctttaaatcaagtaataactcgcaaagcggtgcaggagat
acacaaacgcaagaaagtattacatcggctaatcctttaaaaattactcagaattggtat
gaagagcgatctgataagttacttgttcaacgtaacttacttatcatattaataatacta
ctaaccatttttatggttatagcaactttagtaatagcctttgtagtgaaatctaaacag
tttgagccttttgttattcagcttaatagtaataccggacgtgcctcagtggtagaacct
atttcatcaccagtgttaacggcggatgagtctcttacaaggtattttataaagaaatac
ataacggcacgggaaacatataatccagttgattttgcgacgatagctcgtacgacaata
agattattttcaacaagcagtgtttattacaattatcttggctatataagaaataaagat
tttgatcctactttaaaatataaagaagagaatactacatttttagtaataaaatcatgg
tcaaaaatcgcagcagataaatatatagttagattttccgtaaatgaaacatcaggaaac
caattagtttataataaaatagcggtagtaagttatgcttatgtgcctatgcaattaaca
gattcagaacttgatataaatccggtagggtttcaagtgaacggatatagggtagacgat
gacaatagttag

DBGET integrated database retrieval system