KEGG   Rickettsia africae: RAF_ORF0362Help
Entry
RAF_ORF0362       CDS       T00979                                 

Gene name
virB9-2
Definition
(GenBank) VirB9
  KO
K03204  type IV secretion system protein VirB9
Organism
raf  Rickettsia africae
Pathway
raf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:raf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RAF_ORF0362 (virB9-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raf02044]
    RAF_ORF0362 (virB9-2)
Secretion system [BR:raf02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   RAF_ORF0362 (virB9-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagX
Motif
Other DBs
NCBI-ProteinID: ACP53299
UniProt: C3PMY9
Position
389132..389605
Genome map
AA seq 157 aa AA seqDB search
MTIVRFYFLVFILLSGFTVQRECSLVDDPCNSSNNYVDDLSITKDNRIKTYIYNPNEVYL
LVLHFGFQSHIEFAKNEEVQNIILGDAYAWKITPLANRLFIKPLEKDIRTNMTIITNKRI
YEFDIASTELMMGNERDLVYVIKFYYPKKNSNYIARF
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagttagattttattttttagtttttatattattaagcggttttacagtacaa
cgagaatgttcacttgtagatgatccatgtaatagtagtaataattatgtagatgattta
tctataactaaagataataggataaaaacttatatatataatccaaatgaagtttattta
ttagttttgcattttggctttcaatcgcatatagaatttgctaaaaacgaagaagtccaa
aatataattcttggggatgcttatgcttggaaaataactcctttggcaaatagattattt
attaagcctcttgaaaaagatattcgtacaaatatgactattataactaataaaagaata
tatgaatttgatatcgcttctacggaacttatgatgggtaacgaaagggatttagtatat
gtaattaaattttactaccctaagaaaaatagtaattatatagcaagattttaa

DBGET integrated database retrieval system