KEGG   Rickettsia africae: RAF_ORF0364
Entry
RAF_ORF0364       CDS       T00979                                 

Gene name
virB11
Definition
(GenBank) VirB11
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
raf  Rickettsia africae
Pathway
raf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:raf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RAF_ORF0364 (virB11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raf02044]
    RAF_ORF0364 (virB11)
Enzymes [BR:raf01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     RAF_ORF0364 (virB11)
Secretion system [BR:raf02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   RAF_ORF0364 (virB11)
SSDB
Motif
Pfam: T2SSE AAA_28 AAA_7 MoCF_biosynth AAA_19
Other DBs
NCBI-ProteinID: ACP53301
UniProt: C3PMZ1
Position
391234..392238
AA seq 334 aa
MSEEFAALETFLLPFKNLFAEDGINEIMVNKPGEVWVEKKGDIYSKQIPELDSEHLLALG
SLVAQSTEQMISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYAIRKPSGMNLTLDEYAK
MGAFDDTATESLVDEDAVILNNFLAEKKIKEFIRHAVVSKKNIIISGGTSTGKTTFTNAA
LTEIPAIERLITVEDAREVVLSRHPNRVHLLASKGGQGRANVTTQDLIEACLRLRPDRII
VGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLKLMVMQADLGMPPEEVKKYIL
TVVDIVVQLKRGSSGKRYVSEVYYKKNKNAEGMV
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgagtgaagaatttgcagccttagagacgtttttacttccttttaaaaatttatttgct
gaagacggtattaacgaaattatggttaataagcccggagaagtatgggttgaaaaaaaa
ggtgatatatattctaagcaaataccggaactggatagcgaacatctacttgcattaggg
agtttagtcgctcaatctaccgaacagatgatttcagaagaaaaaccgcttctttcggca
actttgccgaatggctaccgtattcaaatagtatttcctcctgcttgtgagataggacaa
atcatttatgctataagaaagcctagcggtatgaatctaactttagatgaatatgctaaa
atgggggcatttgatgatactgcaacagagagtttagtagatgaagatgcagtaatttta
aataatttcttagctgaaaaaaagattaaagaatttattagacatgcagttgtttcaaag
aaaaatatcataattagcggcggtacttcaaccggtaaaactacttttactaatgcggca
ctcactgaaatacctgcaatagaaagattaattactgtagaagatgctcgtgaggttgtg
ctatcacgccatcctaacagagtgcatttactggcttccaaaggaggacaggggcgtgca
aatgttactactcaagatttaatagaggcctgtttgcgtttaagaccagataggattata
gtaggtgagcttcgaggtaaggaagcttttagttttttgcgtgctattaatacaggtcat
cccggttcaatatcaacactgcatgctgatagtcccgctatggctattgagcagttaaag
cttatggttatgcaagcagatcttggtatgccgcctgaagaagtaaagaagtatatttta
accgttgtagatatcgttgtgcagttaaaacgcggtagcagcgggaaaagatatgtttcg
gaagtatattataagaagaacaagaatgctgaggggatggtttaa

DBGET integrated database retrieval system