KEGG   Rickettsia africae: RAF_ORF1033Help
Entry
RAF_ORF1033       CDS       T00979                                 

Gene name
paaJ
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
raf  Rickettsia africae
Pathway
raf00071  Fatty acid degradation
raf00072  Synthesis and degradation of ketone bodies
raf00280  Valine, leucine and isoleucine degradation
raf00310  Lysine degradation
raf00362  Benzoate degradation
raf00380  Tryptophan metabolism
raf00620  Pyruvate metabolism
raf00630  Glyoxylate and dicarboxylate metabolism
raf00640  Propanoate metabolism
raf00650  Butanoate metabolism
raf00900  Terpenoid backbone biosynthesis
raf01100  Metabolic pathways
raf01110  Biosynthesis of secondary metabolites
raf01120  Microbial metabolism in diverse environments
raf01130  Biosynthesis of antibiotics
raf01200  Carbon metabolism
raf01212  Fatty acid metabolism
raf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:raf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RAF_ORF1033 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    RAF_ORF1033 (paaJ)
   00640 Propanoate metabolism
    RAF_ORF1033 (paaJ)
   00650 Butanoate metabolism
    RAF_ORF1033 (paaJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RAF_ORF1033 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    RAF_ORF1033 (paaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RAF_ORF1033 (paaJ)
   00310 Lysine degradation
    RAF_ORF1033 (paaJ)
   00380 Tryptophan metabolism
    RAF_ORF1033 (paaJ)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RAF_ORF1033 (paaJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RAF_ORF1033 (paaJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RAF_ORF1033 (paaJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:raf04147]
    RAF_ORF1033 (paaJ)
Enzymes [BR:raf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RAF_ORF1033 (paaJ)
Exosome [BR:raf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RAF_ORF1033 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACP53851
UniProt: C3PLL1
Position
complement(1058209..1059360)
Genome map
AA seq 383 aa AA seqDB search
MQRTTFGSFMGSLSTTAAPMLAAHLINDILQNSKIDPALVGEVILGQVITGGSEQNPARQ
TLIYAGIPKEVPGYTINKVCGSGLKSVVLAANSIMMDDNEIVIAGGRENMSLCMHGSYIR
AGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAENISKQFNISRQQQDEFALSSHKKAAKA
QLAGVFKDEILPVEVTIKKTTSLFDHDETVRPDISLEILSKLRPAFDKNVVVTADNASSI
NDGAACLMVVSEEVLKKHNLTPLARIVSYASAGVDPSIMGTAPVPASKKALSKAGWSVND
LEVIEVNEAFAAQSIYVNREMKWDMEKVNVNGGAIAIGHPIGASGGRVLITLIHGLRRAK
AKKGLVTLCIGGGMGMAMCVEAV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaggactactttcggctcgtttatgggtagccttagtacaacggctgcacctatg
cttgctgctcatttaataaatgatatactgcaaaacagcaaaatcgatccagctttagta
ggtgaggtaatcctaggacaggtaataaccggtggtagcgagcagaatccggcgaggcaa
actctgatttatgcgggaataccgaaagaagtgccgggctatacgattaataaagtatgc
ggctcaggtcttaaaagcgtagtacttgcagcaaattcaattatgatggatgataatgaa
atagttatagcaggtgggcgggagaatatgtcgctctgtatgcacggtagctatatcaga
gcaggagctaaattcggcgatattaaaatggttgatctaatgcagtatgacggattaacc
gatgtattttcaggagtatttatgggtattacagccgaaaatatctcgaaacagtttaat
attagcagacaacagcaggacgagtttgccttaagctctcacaagaaagcagctaaagca
cagctagcaggagtttttaaagatgaaatcttacctgtcgaagtaacgattaaaaaaact
actagtttgtttgatcatgatgaaacagtaagacctgatatcagccttgaaattctgagt
aaattacgtcctgcttttgataaaaacgttgtagttacagcggataatgcttcctctatt
aatgacggtgcggcatgtcttatggtagtttccgaagaagttttgaaaaagcataattta
acgccgctagctcgtattgtttcttatgcttcagccggtgttgatccaagtattatgggt
actgcccctgttcctgcatccaaaaaagctttaagtaaagcaggttggagcgttaatgat
ttggaagttatcgaggttaatgaggcgtttgccgctcaaagtatttatgtaaaccgtgaa
atgaaatgggatatggagaaggttaatgttaacggtggagcaatagccatcggtcatccg
atcggggcaagcggcggacgtgtacttattactctgatacacggcttacgcagagctaaa
gctaaaaaaggcttagttactttatgtatcggtggcggtatgggtatggctatgtgcgtt
gaagcggtttaa

DBGET integrated database retrieval system