KEGG   Rickettsia africae: RAF_ORF1109
Entry
RAF_ORF1109       CDS       T00979                                 
Symbol
virB4-2
Name
(GenBank) VirB4
  KO
K03199  type IV secretion system protein VirB4 [EC:7.4.2.8]
Organism
raf  Rickettsia africae
Pathway
raf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:raf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RAF_ORF1109 (virB4-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raf02044]
    RAF_ORF1109 (virB4-2)
Enzymes [BR:raf01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     RAF_ORF1109 (virB4-2)
Secretion system [BR:raf02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   RAF_ORF1109 (virB4-2)
SSDB
Motif
Pfam: CagE_TrbE_VirB AAA_22 FtsK_SpoIIIE ATPase
Other DBs
NCBI-ProteinID: ACP53904
UniProt: C3PLR4
Position
1127518..1129950
AA seq 810 aa
MFSGLRKFDKDLYNYKAPNFIPIACHYNENTLLTKDGKLLQIIKIHGITSEKISDNIQNL
REMVRVSITKNITDYDFAFWLHTIREKQNLDDSTPYKKLLPANIHTLWQRKNHWNNKFVN
TLYISIVHDSTKVNITNFNSLINSLSHKLITDFENNYLDSAFQKLDNITNNILNDLNEFS
AEKLGIIFENDNVFSNPLFLYNRIANLNNNDCLIPIIDLSDAIGRSIYTISSDKMVVTDH
EKNNKFVSLLSIKEYHETPSNTLDKFLQLPIELIITEIFYFVSKKQVISKLHGQDYILKI
TNDSTLLNHKGINKLDAANLDFQFCNQQISIAVIEEDENKLDAAVAKASTELFKLGIIHV
KEDINIEQIFWSQLPANFAFIRRMSPLSVEHIASLTALHNTTLGNQYNPWGKAITLLRTE
KGTPYFMNFHDKTNKGNTCIFGTGKTGKTVLLNFLISEATKYDPTIIYISNNNDSKIFIE
AIEGKWLEPDKQIINPFLVDDTEKSQAFILEFLKLISGHYISPLSEIEISFLEKLKNKIL
SIEKEKRIFSDILKLEDFKEEGGIQILDKLKVFTEEQLYSGLFDGSSLNIEEGKVIGFNL
YKLSDEPFSKQFYPTERKFLEQFNNNLKKHQSISAAVIYAFTYHLSLVGTKPKIFAADNF
DKLYRPEIYYDNINLIYNNLSQNNGIFVSNFNFIYLKSYPKYTIKPWLDLINTKIILPSD
VKIEDLDKILGLSKPEIRKLSQLILSARMFLISKDNESIASELSIAALIGVVRILSSRQE
EMDIYKKILEQHQGPPDNWVNYLYNELNTD
NT seq 2433 nt   +upstreamnt  +downstreamnt
gtgtttagtggtttacgaaaatttgataaagatctatataattataaggctcctaatttt
atacctatagcatgtcattataatgaaaatactttacttaccaaagacggtaaattacta
caaattattaaaatacacggcattacctcagagaaaataagcgataacatacaaaattta
cgtgaaatggttagagtttctataacaaagaatataaccgattatgattttgctttttgg
ctacatacaatacgagaaaaacaaaacttagacgattcaactccttacaaaaaattatta
ccggcaaatattcataccttatggcaaagaaaaaaccattggaataataaattcgttaat
actttatatatatctatagtacatgattctactaaagttaacatcacaaattttaactct
ttaataaattctttatctcataaattaattactgattttgaaaataactacttagattca
gcttttcaaaaattagacaatatcactaataatattttaaatgatttaaacgaattcagt
gctgaaaaactcggtataatatttgaaaatgataatgttttttctaatcctttattttta
tataatcgcatagctaaccttaataataatgattgtttgatacctataatagatttatcc
gatgcaataggtagaagtatttatacaattagcagcgataaaatggtagttacggatcat
gagaaaaataataaattcgtttctttactatctataaaagaatatcatgaaactccttct
aatacactggataaatttttacagttaccgattgaattaataataactgaaatattttac
tttgttagcaaaaaacaagtaatatccaaattgcatggtcaagattatattctaaaaatt
actaacgactcaactttacttaatcacaaagggattaataagcttgatgcagctaattta
gattttcaattttgtaatcagcaaatttcaattgccgttatagaagaagatgaaaataaa
ctagatgcagccgtagctaaagcatcaaccgaactttttaaacttggtattattcatgta
aaagaagatattaatattgagcaaatattttggtcgcaattacctgctaactttgccttt
atacgtagaatgtcgccattatccgtagagcatattgcttctcttaccgctcttcataat
actacactcggtaatcaatataatccttggggtaaggctataactttactgcgaaccgag
aaaggtactccatatttcatgaattttcatgataaaacgaataaaggcaatacttgcatc
tttggtacggggaaaaccggcaaaaccgtattattgaactttttaatatcagaagcgact
aaatacgatccaacaataatttatatctctaataataatgattctaaaatttttatcgag
gcaatagaaggcaaatggttagaaccggacaaacaaattatcaatccatttttagtagat
gatacagaaaaatcacaagcattcattttagaatttttaaaattaatcagtggtcattat
atttcacctcttagcgaaatagagatatcctttctagagaaattaaaaaataaaatttta
tcaattgaaaaagaaaaacgtattttttccgatattttaaaattagaagattttaaggag
gaaggaggaatacaaatacttgataaacttaaagtttttaccgaagaacaattatattcc
ggattatttgacggatcgtctcttaacattgaagaagggaaagttatagggtttaattta
tataaactttctgatgagccgttttctaaacaattttacccgacggagagaaaattttta
gaacaatttaataataatttaaagaaacaccaaagtattagtgcagcagtaatttatgct
tttacttatcatttaagtctagttggcacaaaacctaaaatatttgctgccgataatttt
gataaactttacagacctgagatttattatgataatataaatttaatctataataatttg
tctcaaaataacggtattttcgtcagtaatttcaattttatttatcttaagtcatatcca
aaatatactataaaaccttggcttgatttaattaatactaaaattattctaccatctgac
gttaaaatagaagatttagataaaattttaggtttaagcaaaccggaaatacgaaaatta
tcacagctaatactttctgcaagaatgttcttaattagtaaggataatgaatcgatagct
tctgaattaagtattgccgctttaataggagttgtccgtattttatcaagcagacaggag
gaaatggatatttataaaaaaatacttgaacaacaccaaggtcctccagataattgggtt
aattacctatataatgagttaaatacggactaa

DBGET integrated database retrieval system