KEGG   Rickettsia africae: RAF_ORF1198Help
Entry
RAF_ORF1198       CDS       T00979                                 

Definition
(GenBank) Ribosomal large subunit pseudouridine synthases RluD subfamily protein
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
raf  Rickettsia africae
Brite
KEGG Orthology (KO) [BR:raf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:raf03009]
    RAF_ORF1198
Enzymes [BR:raf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     RAF_ORF1198
Ribosome biogenesis [BR:raf03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    RAF_ORF1198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: ACP53971
UniProt: C3PLY1
Position
1224297..1225238
Genome map
AA seq 313 aa AA seqDB search
MLKYSVPHELNGIRLDKALSSLLENVSRNQIQKAIKDSQVLVNDVIISDPDVLVKENDII
LFSFKEPEELKIATANVALDIIYEDDDLIVINKAAGMTVHPGAGHHDDTLVNALLHHTKN
LSDIGSSERPGIVHRLDKDTTGLMVVAKNNKAHMLLANQIEQRQVIRKYKVLVWGVINPL
EGVIKNNIGRSRSDRQKMTILKYGGKEAVTHYKTLELFYKGSISMVECKLSTGRTHQIRV
QLSHLKHSIVGDQTYGNNDRKIAHSPPELKAKLIDFKRQALHSWYLSFTHPTSNEIMEFS
CELPRDMEEIISL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatattccgtaccacacgaactaaatggcataaggcttgataaagctctatca
tcgcttcttgaaaatgtttcaaggaatcaaatccaaaaagctattaaagattcgcaagta
ctagttaatgatgtaattatttctgatcctgatgttttggtcaaggagaatgatattata
ttattttcttttaaagaacctgaagagctaaaaattgcaacagcaaatgtagcacttgat
ataatatatgaagacgatgatttgatagtaattaacaaagctgcaggtatgacggtacac
ccaggagcagggcatcatgacgatacgcttgttaatgctttattacatcatacaaaaaac
ttatcggatatcggctcatcagaaagacccgggatagtacatcgtttagataaagacact
acgggcttgatggtagttgctaaaaataataaagcacatatgctacttgcaaatcagata
gaacaaaggcaggtaatacggaaatataaagtgttagtgtggggagtaataaatccgcta
gaaggagtcattaagaataatataggtcgcagccgaagcgatcgccaaaaaatgaccata
ttaaaatatggcggcaaagaagccgttacacattataagactctagaattattttataaa
ggtagtattagtatggtggagtgcaagcttagtacgggtagaactcaccaaattagagta
cagctaagccatttaaagcattcgatagtcggcgaccaaacttacggcaataacgaccga
aaaattgctcattctccccctgaactaaaagcaaaattaattgattttaaacgtcaagcc
ctgcattcttggtatttaagttttactcatccgactagtaatgagattatggaattttct
tgtgagttgccaagggatatggaagagataattagtttataa

DBGET integrated database retrieval system