KEGG   Riemerella anatipestifer RA-CH-1: B739_0535Help
Entry
B739_0535         CDS       T02331                                 

Definition
(GenBank) Transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
rag00010  Glycolysis / Gluconeogenesis
rag00052  Galactose metabolism
rag00500  Starch and sucrose metabolism
rag00520  Amino sugar and nucleotide sugar metabolism
rag00521  Streptomycin biosynthesis
rag01100  Metabolic pathways
rag01110  Biosynthesis of secondary metabolites
rag01120  Microbial metabolism in diverse environments
rag01130  Biosynthesis of antibiotics
rag01200  Carbon metabolism
Module
rag_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B739_0535
   00052 Galactose metabolism
    B739_0535
   00500 Starch and sucrose metabolism
    B739_0535
   00520 Amino sugar and nucleotide sugar metabolism
    B739_0535
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B739_0535
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    B739_0535
Enzymes [BR:rag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     B739_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N BcrAD_BadFG RuvC DEDD_Tnp_IS110 Pan_kinase
Motif
Other DBs
NCBI-ProteinID: AFR35139
UniProt: J9R0A9
Position
complement(565812..566777)
Genome map
AA seq 321 aa AA seqDB search
MTVSDLSSRMALGIDIGGTNTKFGLVNHRGEILGKGRIKTDYDDIDDFINTLYKEIEPIL
EQHDAKSQLEGIGIGAPNGNYYKGTIENAPNLKWKGIVPLAEKITAKFGVPCKVTNDANA
AAYGEMMFGAARGMKDFIMITLGTGVGSGVIANGQLVYGHDGFAGELGHTIVKPGGRKHW
STGSEGSLEAYASATGIAITAKKMRAEFPESMLNNYPEEQINAKTVHECALEGDPTAVEV
FRYTGQKLGEALANFVMFSSPEAILLFGGVIKAGDFILKPTRLHMERNLLPIFRGKVKLV
FSELDEADAAILGASSLVWEK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttcggatttgtctagccgtatggctttaggaatagatataggaggtaccaac
actaagtttggtttggtgaaccacagaggggaaattttaggaaaaggcaggataaagaca
gactatgatgatatagatgattttataaacacactctataaagaaatagaacctatatta
gaacaacacgatgctaaaagccaattagaaggtataggcataggagctcctaacggtaac
tattataaaggtactatagaaaatgcacctaacctcaaatggaaaggaatagtgcctcta
gcagagaaaattactgcgaaatttggggtaccgtgtaaggtaactaatgatgccaatgca
gcggcttatggagaaatgatgtttggggccgcaagaggaatgaaagattttataatgata
actctaggtacaggtgttgggagtggagttattgctaatggtcagttggtgtatggtcac
gacggttttgcgggggagctagggcataccatagtgaaacctggaggaagaaagcactgg
agtacaggctcggaagggagtttagaggcttatgcttctgcaacaggcattgcgataaca
gctaaaaagatgagggcagagtttccagaatctatgcttaataactatccagaggaacag
attaacgctaaaacagtacacgagtgtgctttggaaggagaccctacggcagtagaggtc
tttagatatactggtcaaaaattaggggaagcattggctaattttgttatgttctcttct
ccagaggctattttattatttggtggcgttataaaggcgggagatttcattctaaaacca
acaaggctgcatatggagagaaacttgttacctatatttagaggaaaagtaaaattagtt
tttagtgaactagacgaagcagatgcagcgatattaggcgctagttctctagtttgggaa
aagtag

DBGET integrated database retrieval system