KEGG   Rahnella sp. Y9602: Rahaq_0857Help
Entry
Rahaq_0857        CDS       T01422                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
rah  Rahnella sp. Y9602
Brite
KEGG Orthology (KO) [BR:rah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rah03016]
    Rahaq_0857
Enzymes [BR:rah01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     Rahaq_0857
Transfer RNA biogenesis [BR:rah03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    Rahaq_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ADW72482
UniProt: A0A0H3FBU7
Position
919494..920273
Genome map
AA seq 259 aa AA seqDB search
MLEILYQDEHLIAVNKPAGMLVHRSWLDRHETVFVMQTLRDQIGQHVFTVHRLDKPTSGV
LLLALSSDVARLLSQQFENNQMSKVYHAVVRGYVPQDGTLDYALTEELDKIADKFASPDK
APQPAVTHYRVVAQVEMPVAVGRYDTARYSLVELKPETGRKHQLRRHMSHLRHPIIGDSA
HGDLKQNRGMTQHFGCSGLMLHASHMQLPHPVTGEPLSIQARWDHRWQNVVTQFGWQGKI
PELERVEFAETCRQDSAQI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaattttgtatcaggacgaacatctgatcgcagtaaataaacctgcgggtatg
ctggttcatcgcagctggctggaccgccatgaaacggtgtttgtgatgcaaacattgcgt
gatcagattggtcagcatgtgtttacggttcaccggctggataagccgacgtcgggcgtt
ttgctgctggcgctgtccagtgacgtggcgcgtttgctgtcgcagcagtttgaaaataac
cagatgagcaaggtgtatcatgccgtggttcgcgggtatgtgccgcaagacggtaccctc
gattacgcgctgacggaagagcttgataaaatcgccgataagtttgccagtccggataaa
gcgccacagcctgcggtcacgcattatcgcgtggtggctcaggtcgagatgcccgtggct
gttggtcgttatgatacggcccgttatagcctggtagaactgaaaccagaaaccggtcgt
aaacatcagctgcgcaggcatatgtcgcatctgcgtcacccgataatcggagacagcgcg
cacggtgatttaaagcaaaaccggggtatgacgcagcatttcggctgttccgggctgatg
ctgcacgccagtcatatgcaattgcctcatccggttacgggtgagccgttgtcgattcag
gcgcgctgggatcatcgctggcaaaatgtggtgacacagtttggctggcagggaaaaatc
cctgagcttgaaagggttgagtttgcagaaacttgccgtcaggatagtgcacaaatttag

DBGET integrated database retrieval system