KEGG   Rahnella sp. Y9602: Rahaq_1102Help
Entry
Rahaq_1102        CDS       T01422                                 

Definition
(GenBank) integral membrane sensor signal transduction histidine kinase
  KO
K02484  two-component system, OmpR family, sensor kinase [EC:2.7.13.3]
Organism
rah  Rahnella sp. Y9602
Brite
KEGG Orthology (KO) [BR:rah00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rah01001]
    Rahaq_1102
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rah02022]
    Rahaq_1102
Enzymes [BR:rah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Rahaq_1102
Protein kinases [BR:rah01001]
 Histidine kinases
  OmpR family
   Rahaq_1102
Two-component system [BR:rah02022]
 OmpR family
  Unclassified
   Rahaq_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_3 SKA2
Motif
Other DBs
NCBI-ProteinID: ADW72725
UniProt: A0A0H3F9M2
Position
1180581..1181930
Genome map
AA seq 449 aa AA seqDB search
MAIESAKRLRGRLFWKILLGFWFTFVAITQGLWVVFAFYNPHEPPESGIARRFVKLQITS
AVSTLHYGGLPALNAMMADWPQDDRQFFSVSPSLLPAKGNTIKDLEPGKIPHEVVQFVQG
PDGQGYRLKYDVDGLMHEYRPRRHRDWLNMPPPLLWLGGLGGLLFSAVLAWNLTRPMLQM
RKAFGRVAQGDLSVRLFTSMGKRHDELSEVARDFDSMAERLQVLVKAREELLHDVSHELR
SPLARLQLAIGLARQNPSNVESSLSRIEHEAGRLDKMIGELLALSRTESSEIPDEEYFDL
YGLVEAVVNDARYEAQLPGVEIAMYPGSPDNMDYTVKGNAELMRRAVDNVVRNALRFSAR
GQTISVSLAQVEQYLQIEVADQGPGVEEDKLSSIFDPFVRVKSPLSGKGYGLGLAITRKV
MLAHEGKVDARNAQPHGLIISLQVPHWQM
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
ttggctatcgaatccgctaaacgactgcgcggcagactgttctggaaaatactgctggga
ttctggtttactttcgtggcgatcactcagggcctctgggtggtttttgctttctacaat
ccacatgaaccgccggaaagcggaattgcccgccggtttgtgaaactgcaaattacctcg
gctgtttccacgctgcattacggcggtctgcctgctcttaacgccatgatggccgactgg
ccgcaagatgaccgacaattcttctcagtgtcgccgtcgttgctgcctgctaaaggcaat
acgattaaggatctggaacccggtaaaattccgcatgaagtcgtgcagtttgtgcaggga
ccggacgggcagggttaccggctgaaatatgatgttgacgggctgatgcatgaatatcgc
ccgagacgtcacagggactggctgaatatgccgccgccactgttatggctgggtggactg
ggcggtttactgttcagcgccgtactggcatggaacctgacgcggccaatgttgcaaatg
cgtaaagccttcggacgggtggcgcagggggatttatcagtccgcctgtttaccagcatg
ggtaagcggcacgatgagctgtctgaagtggcgcgtgattttgactctatggctgaacgc
ctgcaggtgctggtcaaagcgcgtgaagagctgttgcacgatgtctcgcatgaactgcgt
tctccgctggcacgtttgcaactggcaatcggtctggcgcggcagaatccgtcgaatgtc
gaaagctccctgagtcgcatagaacacgaagcgggcaggctggataaaatgattggcgaa
ctgctggcgttgtcacgtactgaaagcagtgaaatccctgatgaagagtatttcgatctc
tacggattggtggaggcggtcgttaatgatgcccgctatgaagcgcagttgccgggggtc
gaaatcgcgatgtaccccgggtctccggataacatggattacaccgtgaagggtaatgct
gagctgatgcgtcgtgcggtggataatgtggtgcgtaatgccctgcgtttttcggctcgc
ggccaaactatcagtgtttcactggctcaggttgaacagtatttgcaaattgaagtggcc
gatcaggggccgggcgtggaagaagataagctgtcgagtatctttgacccgttcgtgcgc
gtgaaatcgccgctgtcaggcaaaggctacggcctggggcttgcgatcacccgcaaagtg
atgttggcgcatgaggggaaagtagatgcccgtaacgcgcagcctcatggcctgatcatc
agccttcaagtcccgcactggcaaatgtga

DBGET integrated database retrieval system