KEGG   Rahnella sp. Y9602: Rahaq_1130Help
Entry
Rahaq_1130        CDS       T01422                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00010  Glycolysis / Gluconeogenesis
rah00052  Galactose metabolism
rah00500  Starch and sucrose metabolism
rah00520  Amino sugar and nucleotide sugar metabolism
rah00521  Streptomycin biosynthesis
rah01100  Metabolic pathways
rah01110  Biosynthesis of secondary metabolites
rah01120  Microbial metabolism in diverse environments
rah01130  Biosynthesis of antibiotics
rah01200  Carbon metabolism
Module
rah_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rah_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq_1130
   00052 Galactose metabolism
    Rahaq_1130
   00500 Starch and sucrose metabolism
    Rahaq_1130
   00520 Amino sugar and nucleotide sugar metabolism
    Rahaq_1130
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rahaq_1130
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Rahaq_1130
Enzymes [BR:rah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rahaq_1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADW72753
UniProt: A0A0H3F7B4
Position
1211567..1212538
Genome map
AA seq 323 aa AA seqDB search
MTKYSLVGDVGGTNCRLALCALDSGDISQSKTFSGLDYDSLEAVVREYLAQQHQDVEDAC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGLQHLEVINDFTAVSMAIPMLKEDDLLQFG
GKKAQDGKPAVIYGAGTGLGVAHLIHANNQWLSLPGEGGHVDFAPNSEEEDIILEQLRTE
MGHVSAERILSGPGLVNLYRAIVKSDNRVPENFKPKDVTELALADENLDCRRALSLFCVI
MGRFGGNLALNMGTFGGVYIAGGIVPRFLDFFKASGFRAAFEDKGRFKDYLMDIPVFLIT
HDQPGLVGAGAYLRQSIGLPLRP
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatactccctggtgggcgatgtcgggggcaccaactgccgcctggcgctttgc
gcgttggacagcggcgatatttctcagtctaagactttctccgggctggattacgacagc
ctcgaagccgtggtgcgtgagtacctcgcgcagcagcatcaggatgttgaggatgcatgt
attgccatcgcctgcccgatcactggcgactgggtggccatgaccaaccatacgtgggcc
ttttccattgccgaaatgaagaaaaaccttggcctgcaacatctggaagtgatcaatgac
ttcaccgccgtttcgatggcgatcccgatgctgaaagaagatgacctgttgcagttcggc
ggtaaaaaagcgcaggacggcaaaccggcagtgatttacggtgctggcacggggctgggc
gtcgcacacttaattcatgccaataaccaatggttgagtctgccgggcgaaggcggccat
gttgatttcgcgccaaacagcgaagaagaagacatcattcttgagcagttgcgtaccgaa
atggggcacgtttctgccgagcgtattctctccggtccggggctggtgaatctctaccgt
gccattgttaaatcagataaccgcgtgccggaaaacttcaaaccgaaagacgtgacagaa
ctggcgctggcagacgaaaatctggattgccgccgcgcactgtcgctgttctgcgtcatc
atggggcgtttcggtggcaacctggcgctgaacatggggaccttcggcggcgtgtacatt
gccggcggcattgttccgcgcttcctggacttcttcaaagcttccggttttcgtgccgcg
tttgaagacaaaggccgcttcaaagattacctgatggatattccggtgttcctgatcacg
cacgatcagccggggcttgtgggtgccggggcgtacctgcgtcagtctatcggccttcct
cttcgtccttga

DBGET integrated database retrieval system