KEGG   Rahnella sp. Y9602: Rahaq_2279Help
Entry
Rahaq_2279        CDS       T01422                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00900  Terpenoid backbone biosynthesis
rah01100  Metabolic pathways
rah01110  Biosynthesis of secondary metabolites
rah01130  Biosynthesis of antibiotics
Module
rah_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rahaq_2279
Enzymes [BR:rah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Rahaq_2279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADW73889
UniProt: A0A0H3FAF3
Position
2493838..2494701
Genome map
AA seq 287 aa AA seqDB search
MTQQWWPSPAKLNLFLYITGQRPNGYHDLQTLFQFVDYGDSLSFKVRDDGDIVLTTPVEG
VADDENLVVRAARLLQQHAGTSQGADITLQKRIPMGGGLGGGSSNAATVLVALNAIWNCG
LSDTELAQMGVTLGADVPVFVMGHAAFAEGIGEILQPVEPAEKWYLIAHPGVSIATPVIF
SDPQLTRNTPKRTVNVLLDTPYANDCEPIARKRFYEVEQLLSWLLEYAPSRLTGTGACVF
AEFDTESAARQVLDKTPSWSRSFVAQGVNISPLHRFRDVWLRTAGKA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaatggtggccttctccggctaaactcaatttgttcctttatatcaccggc
cagcgcccgaatggctaccatgatctgcagacactgtttcagtttgtggattacggtgac
agcctgagttttaaagtccgcgacgacggcgatatcgtgctgaccacgccagttgaaggc
gttgcagatgacgagaatctggtggtacgcgccgcccgtcttctgcaacagcacgcgggc
acgtctcagggggcagacattaccttgcaaaaacgaattccaatgggcggcggtctgggc
ggcggttcttccaacgccgccactgtgctggtggcactgaatgcgatatggaattgcggc
ctttctgataccgaactggctcagatgggtgtgacgctgggcgcggatgtgccggtcttt
gtgatgggccatgctgcttttgctgaagggattggcgagattttgcagccggtcgaaccg
gcggaaaaatggtatctgatcgcccatccgggtgtcagcattgcgacgccggtgattttc
agcgatccgcaactgaccagaaatacaccaaaacgcactgtaaatgtgcttttagacacg
ccttacgcaaatgattgcgaaccgattgcgagaaaacgtttttacgaggttgaacagcta
ctttcttggctgttagaatacgcgccgtcgcgactgaccggaacgggtgcctgtgtgttt
gcggaattcgacaccgagtctgccgcccgtcaggttttagacaaaacaccatcgtggagt
cggagttttgtcgcacaaggtgttaatatctcgccgttgcaccgttttcgtgacgtctgg
ttgagaactgcgggcaaagcgtag

DBGET integrated database retrieval system