KEGG   Rahnella sp. Y9602: Rahaq_2464Help
Entry
Rahaq_2464        CDS       T01422                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00250  Alanine, aspartate and glutamate metabolism
rah00330  Arginine and proline metabolism
rah01100  Metabolic pathways
rah01110  Biosynthesis of secondary metabolites
rah01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rahaq_2464
   00330 Arginine and proline metabolism
    Rahaq_2464
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rah03000]
    Rahaq_2464
Enzymes [BR:rah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     Rahaq_2464
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     Rahaq_2464
Transcription factors [BR:rah03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    Rahaq_2464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: ADW74071
UniProt: A0A0H3FA47
Position
2705919..2709893
Genome map
AA seq 1324 aa AA seqDB search
MGMTTMGVKLDEGTRDRLKEAAHKIDRTPHWLIKQAIFSYLERLENGDTLPEIPALNGAA
PEGMEDVAVQLVQEAHQPFLDFAEQILPQSVSRSAITAAYRRPEPEAVSMLLEQARLPAP
LNDAALKLAADIATRLRNQKSANGRAGMVQSLLQEFSLSSQEGVALMCLAEALLRIPDKP
TRDALIRDKISNGNWHSHLGRSPSLFVNAATWGLLFTGKLVATHNEASLSKSLNRIIGKS
GEPLIRKGVDMAMRLMGEQFVTGETIAEALANARKHEEKGFRYSYDMLGEAALTAKDAQA
YLQSYQQAINAIGKASNGRGIYEGPGISIKLSALHPRYSRAQYERVMEELYPRLLSLTLL
ARSYDIGINIDAEEADRLEISLDLLEKLCFEPELAGWNGIGFVIQAYQKRCPMVIDYLTS
LAQRSRRRLMVRLVKGAYWDSEIKRAQMDGLEDYPVYTRKVYTDVSYLACARKLLAVPNL
IYPQFATHNAHTVAAIYQLAGNNYYPGQYEFQCLHGMGEPLYEQVVGKISDGKLNRPCRI
YAPVGTHETLLAYLVRRLLENGANTSFVNRIADATLPIDELVADPVLAVEALAASEGQVG
LPHPRIALPRNLYGEKRVNSAGLDMSSEHRLASLSSALLQSASHPVKAQPIIDAQTDDGE
FLPVINPSENTDIVGYVREATEAEISRALDASTAAGSIWFATPPEERAAILQRAAELMEA
QLQNLLGVLVREAGKTFNNAIAEVREAVDFLHYYAGQIREDFANDTHRPLGPVVCISPWN
FPLAIFTGQIAAALAAGNSVLAKPAEQTPLIAALAVSILHEAGVPTGVLQLLPGRGETVG
SQLVNDERVRGVLFTGSTDVAGILQRNIAGRLDLQGRPTPLIAETGGLNAMIVDSSALTE
QVVTDVVASAFDSAGQRCSALRVLCIQDDVADHTLQMLRGAMAECRMGNPERLSTDIGPV
IDAEAKAGIEKHIDAMRTKGRTVYQAAQEFTADQQEWSRGTFVKPTLIELESFDEMKKEI
FGPVLHVVRYARQDLDKLIGQINAAGYGLTLGIHTRIDETIHRVTQQAHVGNMYVNRNMV
GAVVGVQPFGGEGLSGTGPKAGGPLYLYRLLSSRPQDAVQQTLLRQDRELPLDTSVREAL
LAPHRALQQWATEQKHREEFVAVCERFAQTSQGGTLRTLPGPTGERNTYALLPRERVLAL
ADNQEDALTQLAAVTATGCRILWPEAPLQRDLFSILPKAVQARVDFAKDWQNDAQVFDAV
IYHGDADQLRELCQTIAQRPGAIISVQGFARGEDNILLERLLHERSLSVNTAAAGGNASL
MTIG
NT seq 3975 nt NT seq  +upstreamnt  +downstreamnt
atgggtatgacgacgatgggcgtgaagctggatgaaggtacacgcgacaggctgaaagaa
gcggctcacaaaattgaccgcacaccgcactggctgatcaaacaagcgatattttcctat
ctggaacgactggaaaatggcgatacgctgccggaaattccggcgctgaatggcgctgcg
cctgaaggtatggaagatgtcgctgtgcaactggttcaggaagcccatcagccgttccta
gatttcgccgagcagatcctgccacagtcagtcagccgttctgccatcactgccgcctat
cgccgccctgaacctgaagccgtgtcgatgctgcttgaacaggcgcgtttgcctgccccg
ctcaatgatgctgcgctgaaactggctgctgacattgccaccagactcaggaaccaaaag
agtgcaaacggccgcgccggtatggtgcaaagcctgctgcaggagttctctctgtcttct
caggaaggcgtggcgctgatgtgtctggcggaagcgctgctgcgtattcccgacaaacca
acccgcgatgcgttaatccgcgacaaaatcagcaacggtaactggcattcgcatctgggc
cgcagcccgtcgctgttcgttaacgccgcgacctggggtttgctgttcaccggcaagctg
gtggcgacgcataatgaagcgagtctgtcaaaatcgctgaaccgcattatcggcaaaagc
ggcgaaccgctaatccgcaaaggtgtggacatggcaatgcgcctgatgggagagcaattc
gtgaccggcgaaaccatcgccgaagcgctggccaatgcccgcaaacatgaagaaaaaggc
ttccgctattcctacgacatgctgggtgaagccgcgctcaccgcgaaagacgcgcaggcc
tatttgcagtcctatcagcaggcgatcaatgccatcggcaaagcctccaatggtcgcggc
atttatgaaggccccggcatttccatcaagctttccgccctgcatccgcgttacagccgt
gcgcaatatgaacgtgtaatggaagagttgtatccgcgcctgctttcactgaccttgctg
gcacgcagttacgacatcggtatcaacatcgatgccgaagaagctgaccgcctggagatc
tctctcgatttgctggaaaaactctgcttcgaaccggaactggcgggctggaacggcatc
ggcttcgtgattcaggcgtatcagaaacgctgcccgatggtgattgattacctgaccagt
ctggcacagcgcagccgccgccgtctgatggtccgtctggtgaaaggtgcgtactgggac
agcgaaattaagcgcgcacaaatggacggtctggaagattatccggtttatacccgcaag
gtttacaccgatgtctcctatctggcctgcgcccgtaaactgctggccgtgccaaacctg
atttatcctcagttcgcgacgcataacgcccacaccgtggcggcgatttatcaactggcc
ggtaataactattatcccggtcagtacgaattccagtgcctgcacggtatgggtgaaccg
ctgtacgagcaggtggtggggaaaatttctgacggcaaactgaaccgcccgtgccgcatt
tatgccccggtcggtacacacgaaacactgttggcgtacctggtacgtcgtctgctggaa
aacggcgcgaatacctcctttgttaaccgtattgccgatgccacgttaccgatcgatgaa
ctggttgccgatccggttctggcggtcgaagcgcttgccgccagcgaaggtcaggtcgga
ttaccccatccgcgaatcgccctgccgcgcaatctttatggcgaaaaacgtgtgaattct
gccggtctcgatatgtccagcgagcaccgtctggcctccctttccagcgccctgctgcaa
agcgccagccacccggtcaaagcgcagccgataattgatgcgcaaacggacgacggcgaa
ttcctgccggtgatcaacccgtctgaaaataccgatattgtcgggtatgttcgcgaagcg
acagaagctgaaatcagccgcgcgctggatgcctcaaccgctgccgggtcaatctggttt
gcgacacctcccgaagaacgtgccgccatcctgcaacgcgctgcagaactgatggaagcg
cagttgcaaaacctgctcggcgtgctggtgcgcgaggcgggaaaaacctttaataacgcc
attgccgaagtacgtgaagccgtggacttcctgcattattacgccgggcagatccgcgaa
gatttcgccaatgacacgcaccgtccgctggggccggtggtctgtatcagcccgtggaac
ttcccgctggcgatctttaccggtcagattgctgccgcgctggccgccgggaacagcgtg
ctggcaaaaccggcagaacagacgccgctgattgctgcattagccgtcagcattctgcat
gaagccggagttccgacaggcgtattgcagttgctgccgggccggggtgaaacggtcggt
tcgcaactggtcaatgacgaacgtgtacgcggcgtgctgtttaccggttcgacggatgtc
gcgggtattctgcaacgcaacatcgccggtcgtctggatctgcaggggcgtccgacgccg
cttatcgccgaaaccggcgggctgaacgccatgattgtcgattcctccgccctgaccgaa
caggtagtgacggatgtggtcgcgtcggctttcgacagcgccggtcagcgctgctccgcc
ctgcgcgtgttgtgtattcaggacgacgtcgccgaccacacgctgcaaatgctgcgcggt
gcgatggcggaatgccggatgggcaatccggagcgcttgtctaccgacatcgggccggtg
atcgacgccgaagccaaagccggtatcgaaaaacacatcgatgcgatgcgcaccaaaggc
cgcaccgtgtatcaggctgcgcaggaatttacggctgaccagcaggaatggagccgcggt
acctttgttaaaccgacgctgatcgagctggaaagcttcgatgagatgaagaaagaaatc
ttcgggccggtgctgcacgtggtgcgttatgcccgccaggatctggataagctgatcggt
cagattaatgccgccggttatggcctgacgctgggtattcatacccgcatcgacgaaacc
attcatcgcgttacgcagcaggcacacgtcggcaatatgtacgtgaaccgcaatatggtg
ggtgctgtcgtgggtgtgcaaccttttggcggcgaaggcttgtccggcaccggtccgaaa
gccggtggcccgctgtatctttatcgtctgctgagcagccgtccgcaagacgccgtccag
caaaccctgttacgtcaggatcgcgaactgccgctcgatacttccgtgcgcgaagccttg
ctggcaccgcaccgggcgctgcaacaatgggcaacggagcagaaacaccgtgaggagttt
gtcgcagtttgcgaacgtttcgcccaaaccagtcagggcggcaccttgcgcacactgccg
gggccaaccggcgagcgtaacacttacgcactgttaccgcgtgagcgcgttctggcactg
gcagataatcaggaagatgccctgacccagcttgccgctgtcaccgcgacaggttgccgc
attctctggccggaagcgccattgcaacgtgatttgttcagcatcctgccaaaagcagtg
caggcgcgagtcgatttcgccaaagactggcagaacgatgcgcaggtatttgatgcagtg
atttatcacggtgatgcggatcagttgcgcgaactttgtcagaccattgcgcagcgtccg
ggcgccattatatcggtacagggctttgcacgcggcgaggataatattctgctggaacgc
ctgttgcatgaacgttcactgagtgtgaatacggcagccgccgggggcaatgcgagtctg
atgacgatcggataa

DBGET integrated database retrieval system