KEGG   Rahnella sp. Y9602: Rahaq_2620Help
Entry
Rahaq_2620        CDS       T01422                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase., Phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rah01100  Metabolic pathways
rah01110  Biosynthesis of secondary metabolites
rah01130  Biosynthesis of antibiotics
rah01230  Biosynthesis of amino acids
Module
rah_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rahaq_2620
Enzymes [BR:rah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Rahaq_2620
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Rahaq_2620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI Adenine_deam_C
Motif
Other DBs
NCBI-ProteinID: ADW74227
UniProt: A0A0H3FH87
Position
2852683..2854047
Genome map
AA seq 454 aa AA seqDB search
MQQETVLHKIVRDKEIWVAARKDQQPLASFQNDITQSQRSFYHALQGARTAFILECKQAS
PSKGKIRDNFDPVEIASVYKDYASAISVLTDEKYFQGSFDFLPLVSKTVTQPVLCKDFII
DPYQIHLARFYQADAILLMLSVLDDDQYVQLAAVAHSLNMGVLTEASNEEELDRAVKLKA
KVVGINNRDLRDLSIDLNRTRELAPRVPHGVTVISESGINTYGQIRELSRFANGFLIGSA
LMSEQDLSSAVRRVLLGENKVCGLTRAQDAKAAHEAGAIYGGLIFVEASPRFVTQTQAKE
VQNGAPLKYVGVFRDEEITTVAQTAQTLNLAAVQLHGDEDQVYIDALRTALPQTVQIWKA
LSVKETLPARDLNHVDRYVLDNGKGGTGHRFDWSKLAGQDLSNTLLAGGLSADNCVEAAQ
LGCAGLDFNSGVESEPGIKDAGKINAVFQTLRAY
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggaaaccgtgctccacaaaattgttcgcgataaagaaatttgggtcgcggca
cgtaaagatcagcaaccgctggccagctttcagaacgacataactcagagccagcgcagt
ttctaccatgccctgcaaggggcaagaaccgcctttattctggagtgcaaacaagcgtct
ccgtcgaaaggcaagatccgcgataactttgatccggtagaaatcgccagcgtttataaa
gactacgcttccgccatctccgtattaacggacgaaaaatacttccagggcagttttgat
tttctgccgctggtgagcaaaaccgtcacacagcctgtgctgtgcaaagattttattatc
gacccgtatcagatccatctggcccgtttctatcaggctgatgcgattttgctgatgctg
tcagtgctcgatgacgatcagtacgttcagctcgccgcggttgctcacagccttaacatg
ggggtgctgacggaggccagtaatgaagaagaactggatcgcgccgttaaactgaaagcc
aaagtcgtcggtatcaataaccgcgatttgcgcgatttgtctatcgacctgaaccgcacc
cgtgagctggcaccgcgcgtaccgcatggcgtcacggtcatcagtgaatcaggtattaat
acttacggacaaatccgtgaactgagccgcttcgccaatggcttcctgatcggcagtgcg
ctgatgtcggaacaagacctgagcagtgccgttcgtcgcgtgctgctcggtgaaaacaag
gtctgtggcctgacccgcgctcaggatgccaaagccgcgcacgaagctggtgctatttat
ggcgggctgatttttgttgaagcctcaccgcgtttcgtgacacagacgcaggcgaaagaa
gtgcagaacggcgcaccgctgaagtatgtcggcgtgttccgcgatgaagaaatcaccaca
gtggcccagacggctcagacattaaacctggccgccgtgcagcttcatggcgacgaagat
caggtttatatcgatgccctgcgcacagccttgccgcaaacggttcagatctggaaagcg
ctgagcgtcaaagaaacattgccagcgcgcgacctgaatcacgtggatcgttacgtcctg
gacaacggcaaagggggcacgggtcaccggttcgactggagcaaactggccggtcaggat
ttgagcaacaccttactcgccggtggactgagcgcagataactgcgtcgaagccgcacaa
ctcggttgcgcaggcctggatttcaactcaggtgttgaaagcgagccgggcatcaaggat
gccgggaaaattaatgccgtattccagacattgcgggcgtattaa

DBGET integrated database retrieval system