KEGG   Rahnella sp. Y9602: Rahaq_3032Help
Entry
Rahaq_3032        CDS       T01422                                 

Definition
(GenBank) inner-membrane translocator
  KO
K02057  simple sugar transport system permease protein
Organism
rah  Rahnella sp. Y9602
Module
rah_M00221  Putative simple sugar transport system
Brite
Transporters [BR:rah02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    Rahaq_3032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: ADW74626
UniProt: A0A0H3FF08
Position
3286835..3287845
Genome map
AA seq 336 aa AA seqDB search
MNKAVVSKENVPDARQPWRHQLFEFLYKWGMLLTVVLLIAAFGLASDNFLEPSNIINILR
SIAIVTVIAIGVSISLAVGGFDLSVGSTASLANALVISMFVWHGFGTTEAILITLALCTL
VGLFNAFLIVILKIPDMLATLASLFVIQGAAMTYSYGGSITENMLLPSGDMAEGTVPAVF
SLLGQVPVIVIVMAVVTIAVQLFMSLTKHGRRMYAIGGNPLAARLAGIRTARYRVIAYVM
SSVLAGAGGILLASRIGSSQVNAGGGYLMDAVAAAYIGFSLAGSGKPNALGTLLGAVILG
VLSNGLVMLSVPYYAMDIIKGLVLAVALALTYIQKR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaagccgtggtgagtaaagaaaacgtgcccgatgcccgccagccgtggcgtcat
cagctgttcgaatttttatataaatggggcatgttgctgaccgtggtgttgctgatcgcc
gcttttggtctggcgtcagataacttcctcgaaccgtcgaacatcatcaatatcttgcgt
tcgattgccatcgtgacggtgattgccatcggcgtgtcgatttccctggcggtcggcggc
ttcgatttatcggtcggctccacggcatcgcttgccaatgcgctggtgatttcgatgttc
gtctggcacggtttcggcacgaccgaagcgatacttatcacgctggcgttgtgcacgctg
gtcggcctgttcaacgcctttctgatcgtcatcctgaaaattcctgacatgctggcaacg
ctcgccagtctgtttgtgattcagggcgcagcgatgacttacagctacggcggttccatc
actgaaaacatgttattgccgagcggcgacatggccgaaggcacggtacctgcggtgttc
agcctgctcggtcaggtgccggtgattgtgatcgtgatggccgtcgtgaccattgcggtg
caactgtttatgtcgctgaccaagcatggccgccgcatgtacgccatcggcggaaatccg
ctggccgcacgtctggcggggatccgcaccgcgcgctaccgcgtgattgcttatgtgatg
tcatccgtgcttgccggtgcaggcgggattttgctggcttcacgcatcggttcttcgcag
gtgaatgccggtggcggctatctgatggatgccgttgccgccgcttatatcggtttctcg
ctggcgggttccggtaaaccgaatgcgctgggaaccttgctgggcgcggtgattttaggc
gtgctgtcgaacgggctggtgatgttgtcggtgccgtattatgcgatggatatcatcaaa
gggttagtgctggcagtggcgttagcgctgacgtatatccagaagagatag

DBGET integrated database retrieval system