KEGG   Rahnella sp. Y9602: Rahaq_3253Help
Entry
Rahaq_3253        CDS       T01422                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00300  Lysine biosynthesis
rah01100  Metabolic pathways
rah01120  Microbial metabolism in diverse environments
rah01230  Biosynthesis of amino acids
Module
rah_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rahaq_3253
Enzymes [BR:rah01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Rahaq_3253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADW74847
UniProt: A0A0H3FFN3
Position
3520758..3521885
Genome map
AA seq 375 aa AA seqDB search
MSCPVLDLAQQLIRRPSLSPDDAGCQEIMIARLEAIGFHIEPMHFGDTLNFWATRGEGKT
LAFAGHTDVVPTGDHKLWVTGPFEPTLRDGMLYGRGAADMKGSLAAMVVAAERFVAANPH
HQGRLAFLITSDEEASAVNGTVKVVNALMARNERLDYCLVGEPSSTTRVGDIVKNGRRGS
MTANLHVHGVQGHVAYPHLADNPVHRAMPALNELVATVWDNGNEFFPPTSMQIANINAGT
GSNNVIPGELYVQFNFRFSTELTDAIIKQRVAELLDRHNLQYTLNWVVSGQPFLTSRGEL
VDAVVNAVRHYSEITPELQTTGGTSDGRFIALMGAQVVELGPVNATIHKINECVHAADLQ
VLSRMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtccggttctcgatttagcgcaacagttaatccgccgcccttccctcagcccg
gacgatgcgggttgccaggagattatgattgcccgccttgaggccattggttttcacatt
gagccgatgcattttggcgataccctgaatttctgggcgacacgtggtgaaggcaaaacc
ctggcctttgccgggcataccgatgtggtccctaccggcgatcataagctgtgggttacc
ggcccgtttgagccaacgctgcgcgacggcatgctgtatggtcgcggcgcggcagacatg
aaaggctcactggcggcgatggtagtggcagcagagcggtttgtcgccgccaatccccat
catcagggtcgtctggcttttctcatcacttctgatgaagaagccagcgccgtcaacggc
accgtcaaagtggtcaacgcgctgatggcacgcaatgagcgccttgattactgtctggtc
ggcgagccttccagcaccacgcgcgtcggcgatattgtgaaaaatggccgtcgcggttcc
atgaccgccaacctgcatgtgcatggcgttcaggggcatgtggcgtatccgcatctggcg
gataatccggtacaccgcgccatgcccgcgctgaatgagctggtcgccaccgtgtgggat
aacggtaacgaattcttcccgccaaccagcatgcaaattgccaatatcaacgcgggcacc
ggcagcaacaacgtcattccgggcgaactttatgtgcagttcaacttccgtttcagcacc
gagctgactgatgccatcatcaaacagcgcgtcgccgaattactggatcgccataacctg
caatacaccctgaactgggtggtttccggccagccattcctgacatcacgcggtgagctg
gtggatgccgtagtcaatgcggtgcgccattacagtgaaatcacgccggaactgcaaact
accggtggtacctctgacgggcgttttatcgcgctgatgggggcgcaggtggttgaactc
gggccggtcaacgcgactatccacaaaatcaatgaatgcgtacatgccgccgatctgcag
gtgctcagccgcatgtatcagcgcatcatggaacaattagtcgcatga

DBGET integrated database retrieval system