KEGG   Rahnella sp. Y9602: Rahaq_3885Help
Entry
Rahaq_3885        CDS       T01422                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
rah  Rahnella sp. Y9602
Brite
Enzymes [BR:rah01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     Rahaq_3885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Glyco_hydro_42C
Motif
Other DBs
NCBI-ProteinID: ADW75474
UniProt: A0A0H3FDU7
Position
4239986..4241788
Genome map
AA seq 600 aa AA seqDB search
MSSVNLEYVLRLESLLSRIYPREHIADLLKKILHLADKWNYGKHRTTRWVDGTNIYLITY
GDNIRHGEQPPLATLNHFANTYLRDIISDIHILPMYPYSSDDGFSVIDYRRIDEHLGGWS
DIHHLSANFNLMFDCVINHISRSSEWMKGYLHDDPYYKDYFIAANPELDYSRVVRPRASP
LLSPFIKTDGTELYLWTTFSEDQIDINFKNPQVLLESIDVLLQYAASGGQSIRLDAIGYI
WKEAGTRCIHMPQAHNIIKVWRTILDEVIPGTRIITETNVPHHENISYFGEGDEAHMVYQ
FPLPPLTLHAFLRQDTTTLTQWAQSLNAEARYPDTTYFNFLASHDGIGLRPTETFLTDDE
RKYMAQETLRKEGRVSYKDNGDGTHSPYELNINYLSALTEPEDNTEMKARKFLAAQALLL
SFIGVPAIYIHSLLGSENDLDGMHQSGINRRINRKKLDLMDIEAELEKKDGLRARIFYGL
QALIRHRREHPAFSPQAGQRVFDLGKSLFAMERYDPKTEDRISCIFNISDHSQMLKLAVE
GKDLISGEVFNGQMRLQPWQVVWIKHKLKAPERLGRLRRWRMKLIKRTKRYTISIKRTMR
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagctcagtcaatcttgagtatgttctgcggctggaaagcctgttaagcaggatttac
ccccgggaacacatcgccgacctgctgaaaaaaatcctgcatctcgccgacaaatggaat
tacggcaaacaccgcaccacccgctgggtggatgggaccaatatttatctgattacttat
ggcgataatatccgtcacggcgagcaaccgccgctggcgacgctcaatcatttcgctaac
acttatctgcgcgacattatcagcgacatccatattctgccgatgtatccgtacagttca
gacgacggcttcagcgtcattgactaccggcggatcgatgaacatcttggcggctggtca
gatattcatcacctttcggccaatttcaacctgatgtttgattgcgtgatcaaccatatt
tcccgctcaagcgaatggatgaaaggctatctgcatgacgatccgtattacaaagattac
tttattgccgctaatcccgagctggattacagccgcgtcgtgcgcccgcgcgcttcgccg
ctgctctcgccatttatcaaaaccgacggcaccgaactgtatctgtggacgacgttcagt
gaagatcagatcgatattaatttcaagaatcctcaggtcttgctggaaagcattgatgtg
ctgttgcaatacgccgccagcggcggacagtcgatccgccttgatgcgattggctatatc
tggaaagaagccgggacgcgctgcattcacatgccacaggcgcataacatcattaaagtc
tggcgcactattctcgatgaagtgatccccggcacgcggatcatcactgaaaccaacgtc
ccgcaccacgaaaatatcagttatttcggcgaaggtgacgaggcacacatggtgtatcag
ttcccgctgccaccgctgaccttgcacgcttttttgcgtcaggacaccaccacgctcacc
caatgggcgcaaagcctgaatgcggaagcccgttaccctgacaccacctatttcaacttc
cttgccagccacgacggcatcggtttacgtccgaccgaaaccttcctgaccgatgacgaa
cgtaaatacatggcgcaggaaacgctgcgcaaggaaggccgcgtgtcctacaaagacaac
ggcgacggcacccattcgccttacgaactgaacattaattacctgagcgcgctgaccgaa
ccggaagataataccgagatgaaagcccgcaagtttctggcggcacaggcgctgttattg
tcgtttatcggcgtcccggcgatttatattcacagcctgctgggcagcgagaacgatctc
gacggcatgcatcagtccgggatcaaccgccgcatcaaccgtaaaaagctggatctgatg
gatattgaagctgaactggaaaaaaaagacggcttacgcgcccgcattttttacggatta
caggcactcatcaggcaccgccgcgagcacccggcattttcaccgcaggctggccagcgc
gtgtttgatctgggcaaatcgctgtttgcgatggaacgctatgatccgaaaaccgaagac
cggatcagctgcatattcaatatcagcgatcattcgcagatgctgaagctggcggtcgaa
gggaaggatctgattagcggagaagtatttaacggccagatgcgtctccagccgtggcag
gtggtgtggatcaaacacaaactcaaagcgccggaacgtctcggcaggctgcgtcgctgg
cggatgaagctgatcaagcgcacaaagcgctacacaataagcattaagcggacaatgcgc
tga

DBGET integrated database retrieval system