KEGG   Rahnella sp. Y9602: Rahaq_4078Help
Entry
Rahaq_4078        CDS       T01422                                 

Definition
(GenBank) 3-hydroxyisobutyrate dehydrogenase
  KO
K08318  4-hydroxybutyrate dehydrogenase / sulfolactaldehyde 3-reductase [EC:1.1.1.61 1.1.1.373]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00650  Butanoate metabolism
rah01100  Metabolic pathways
rah01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Rahaq_4078
Enzymes [BR:rah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.61  4-hydroxybutyrate dehydrogenase
     Rahaq_4078
    1.1.1.373  sulfolactaldehyde 3-reductase
     Rahaq_4078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored UDPG_MGDP_dh_N 3HCDH_N TrkA_N IlvN 2-Hacid_dh_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ADW75666
UniProt: A0A0H3FEC7
Position
complement(4438204..4439100)
Genome map
AA seq 298 aa AA seqDB search
MANVAFIGLGQMGAPMAANLIKQGHRLAVFDLNPQTVNSLIQQGATGSKSAAEAAAGAEF
VITMLPNGDLVSEVLFGRDGICETLSPSALVIDMSTIHPLQTDKLIAQMHEKGFSMMDVP
VGRTSDHAVAGTLLLLAGGTAEQVERARPVLMAMGSELINAGGPGKGIRVKLINNYMSIA
LNALSAEAAVLCEALDLSFDVALQVMSGTPAGKGHFTTSWPNKVLKGDLSPAFMIDLAHK
DLGIALDVANQLHVPMPLGAASREVYNQARAAGRGRQDWTAILEQVRTSAGLAQKTHP
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgtggcatttattggtctggggcaaatgggcgctccgatggcggccaatctg
attaaacagggacaccggttagcggtgttcgatctcaacccgcagacggttaactcactg
atacaacagggggcaacgggcagcaagagcgcggcagaagcggcggcgggcgcagaattt
gtcattactatgctgcccaacggcgatctggtaagtgaggttttatttggccgtgatggt
atttgcgaaaccctgagcccgtccgcgctggttattgatatgtcgactatccatccgtta
cagaccgacaagctgattgcgcagatgcatgaaaaaggtttcagcatgatggatgtgccg
gtgggcagaacctctgatcacgcagtggccggtaccttactgctactggcaggcggcacg
gcagaacaggttgagcgcgcgaggccagtgttgatggcgatgggctcggagctgattaat
gcgggcgggccgggcaaaggcatccgcgtcaagctgatcaataactacatgagtattgcc
ctgaatgcgctctccgccgaagccgccgtgctgtgcgaagcgctggatctctcttttgat
gtggcgctgcaggtaatgagcggcaccccggccggaaaaggtcacttcaccacctcatgg
ccgaacaaagtgctgaaaggtgatttgtcaccggccttcatgattgacctcgcccataaa
gacctcggtatcgcgctggacgtcgctaatcagctgcatgtgccgatgccgctcggtgcg
gcttcccgcgaagtgtacaaccaggcgcgtgccgccgggcgcgggcgtcaggactggacc
gccattcttgagcaggtgcgcaccagcgccggtctggctcagaaaacacatccgtaa

DBGET integrated database retrieval system