KEGG   Rahnella sp. Y9602: Rahaq_4286Help
Entry
Rahaq_4286        CDS       T01422                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00471  D-Glutamine and D-glutamate metabolism
rah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rah00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Rahaq_4286
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rah01011]
    Rahaq_4286
Enzymes [BR:rah01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Rahaq_4286
Peptidoglycan biosynthesis and degradation proteins [BR:rah01011]
 Precursor biosynthesis
  Racemase
   Rahaq_4286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF4166
Motif
Other DBs
NCBI-ProteinID: ADW75872
UniProt: A0A0H3FEZ0
Position
complement(4691360..4692241)
Genome map
AA seq 293 aa AA seqDB search
MATKHQDVSTTLLEAIPSDTTQVPDRPTVLVFDSGVGGLSVYDEVRQMLPDLHYIYAFDN
VAFPYGEKSEEFIVERVVEIVTAVAKRHPLSIIVIACNTASTVSLPALRAKFSCPVVGVV
PAIKPAAKLTRNGVVGLLATRATVQRPYTHDLVARFATDCQILMLGSAELVELAEAKLHG
EEVSLAALKKILHPWLRLREPPDTVVLGCTHFPLLSQELSQVLPDGTRMIDSGSAIARRA
HWLIETSHVPIPERKADVEIECVAYCMAMTAEAQSLLPVLQAYGFRSIQELPL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggctacgaaacaccaggacgtgagtacaaccttactggaagctataccttctgataca
acacaagttcctgaccgcccgacggtgctggttttcgattctggcgtcggcgggttgtcg
gtttatgatgaggtccggcagatgttgccggacctgcactatatatatgccttcgataat
gtggctttcccctacggcgagaaatccgaagagtttatcgttgagcgcgtggtggagatt
gtcaccgctgttgcgaaacgccatcccctttctattattgtcatcgcctgcaacactgcg
agcaccgtttctctccccgcattacgcgccaaattcagttgtcctgttgtcggggttgtc
ccggcaatcaaacctgcagctaaattaacgcgtaatggtgtggtcggattgctggcgacc
cgtgcgacagttcagcgtccttatacgcatgatctggtcgcacgctttgcgacggattgt
cagattctgatgctgggttcggcggaactggtagaacttgcggaagcgaagctgcatggt
gaagaggtttcgttagcggcgttgaagaaaatcctgcatccttggttgcgtttacgtgaa
ccgccagacacggtggtcttaggttgcacgcatttcccgctgctttcgcaagagctgtca
caggttttacccgacggcacgcgtatgatcgactcgggttctgcgattgcgaggcgtgcg
cattggttaattgaaacttctcatgtgccaattcctgaaagaaaagccgatgtggaaatc
gagtgtgtcgcctactgcatggcgatgactgcagaggcgcaaagtttgctgcctgtttta
caggcatatggcttcagaagtatccaggaattgccgctttaa

DBGET integrated database retrieval system