KEGG   Rahnella sp. Y9602: Rahaq_4563
Entry
Rahaq_4563        CDS       T01422                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
rah  Rahnella sp. Y9602
Brite
KEGG Orthology (KO) [BR:rah00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rah02044]
    Rahaq_4563
Secretion system [BR:rah02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq_4563
SSDB
Motif
Pfam: T6SS_VipA GerD
Other DBs
NCBI-ProteinID: ADW76144
UniProt: A0A0H3FGG2
Position
pRAHAQ01:124539..125033
AA seq 164 aa
MSNSFQNEIPKARVNIKLDLHTGGAQKKVELPLKLMVMGDYSNGKENRPLSEREKVNINK
NNFNSVLAEFSPSLNLTVENTLTGDRSEENISLNFNEMKDFEPEQVARQIPQLRAMLAMR
NLLRDLKSNLLDNVTFRKELEAILKDPALSNELRTELNALAPKA
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtctaatagcttccagaatgaaattccgaaagcgcgcgttaacataaaacttgatcta
cacactggcggcgcacagaagaaagtcgaattaccgttaaaattgatggtaatgggtgat
tacagtaatggaaaagagaaccgtccgttatctgaacgcgaaaaagttaacattaataag
aataactttaacagcgtactggctgaattcagcccttcactgaacctgaccgtggaaaat
acgctaacaggtgatcgcagcgaagaaaatatctctctaaatttcaatgaaatgaaagat
tttgagccagaacaggttgcccgtcagatcccccaactgcgcgcgatgctggcaatgcgt
aacttattacgtgacctcaaatccaatctgctcgacaacgtcaccttccgtaaagagctc
gaagccattctaaaagatcctgcgctgagcaatgaactgcgcactgaacttaatgccctg
gcgccaaaggcgtaa

DBGET integrated database retrieval system