KEGG   Rahnella sp. Y9602: Rahaq_4570Help
Entry
Rahaq_4570        CDS       T01422                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
rah  Rahnella sp. Y9602
Pathway
rah03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rah00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Rahaq_4570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rah02044]
    Rahaq_4570
Secretion system [BR:rah02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq_4570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Sarcoglycan_1
Motif
Other DBs
NCBI-ProteinID: ADW76151
UniProt: A0A0H3FII8
Position
pRAHAQ01:133664..136006
Genome map
AA seq 780 aa AA seqDB search
MSTSDVINRLLNQSRYRLDVLQSPAFLDVLRFEGEEQLSKPFEYIIHVTSTATDLTAEQL
VLKPATFTMQAPVFDIAGVAEPVRAVHGVIQHFSRISTSADQTIYRLVLVPRVALLDHTA
KCALYLNQSVQEVVEKVLRAHGLEGPDFEFQLSRQYPARELITQWRETDLAFIQRLLAEV
GIYWHLEMDTRLEHDVIIFADSQQQYKFGVRLPLRNQAGMSDSGTESVWGLSTQHQVVTQ
QVSTRDYNYREALSPMDTTASAAGGDETTTGEVYQYAEPFLQSGSEDGVETGAFYARLRH
ERIMNAQKTVTGHSSCPHLAPGQVLEVDGTLPSVLNEGILLTGIKTYGSRKSRFTAQLTG
QPYSETLCFRPVLPERPVIAGTLPARVESTTKGDIYSWLDNQGRYRVKLDFDRDEQEQGY
ACLWLRMAKPYAGDTYGWHAPLLDGTEVAIAFDSGDCDRPYIAYALHDSAHSDHVTDDNH
TRNVLRTPSFNKLRMEDKRSEEHIKLATEFGKTQLNMGHLVDAERAQRGAGFEIRTDEHG
VMRAGKGIFVSAEEQLKAQGKVLDMDPALGQIHQANNEMQALSDAAMQATALASDIQKQL
SFVDNRLTQLQSAAILASAPMGVALTSGEHLQLAARQNLMVNAGNNADVGVMKNLFIGAG
EALSMFVHKQDATLIANQGQVTIQAQNNAMSLTARQTLTITSSDDEIIITTPKKLTLNGG
GSYLTLEASKIEHGSSGDMTIKCTNYLVPMVGASKPSDTPKFPIVTMENLTEENGKDFSG
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctccgatgttatcaacagattgctaaaccagtcccgctatcgtctggacgtt
ttgcaaagtcctgcatttctcgacgtgttgcgcttcgaaggggaagagcaacttagcaaa
ccctttgaatatattattcatgtcaccagcacggccaccgatttaaccgctgaacaactg
gttctcaaaccggctacctttaccatgcaggctcccgtgtttgatattgcaggcgttgcg
gagccggtccgggctgtacacggtgtgattcaacatttttcacgtatctctacctctgcg
gatcagacgatttaccggctggttttggttccgcgcgtagccttactggaccacactgca
aagtgcgcactttatctaaatcagtcagtgcaggaagtggttgaaaaggttcttcgggca
cacggcctggaaggcccggacttcgaattccagctttccaggcaatacccggcacgtgag
cttatcacccagtggcgggaaacagatttagctttcatccagcgtttactggctgaagtc
ggaatttactggcatctcgagatggacacccgccttgagcatgacgtcatcatatttgcc
gacagccagcaacaatataaatttggagtccgtttacccttacgcaaccaggctggcatg
agcgacagcggtaccgaaagcgtctgggggctgagcacgcagcatcaggtcgtcacgcaa
caggtttccacccgcgattacaactaccgggaagcattaagtccgatggacaccactgcc
agtgcggcaggaggtgatgaaactaccactggcgaagtctatcagtacgcggagcctttt
ctgcaatccggatccgaagacggggttgaaaccggtgcattttatgcccgcctgcgtcat
gaacgcataatgaatgctcagaagaccgtcaccggccacagcagttgccctcatctggca
ccgggtcaggtgctggaagtcgatggcacacttccttctgtgttaaatgaaggcatcctg
ctgacggggataaaaacctacggttcacgcaaaagtcgttttaccgcacaattgaccggt
cagccttacagtgaaaccctctgcttccgccctgttctgccagagcgcccggtaatcgcc
ggtacccttcctgcccgggttgaaagcaccaccaaaggcgatatctattcctggctggat
aatcagggcagataccgcgtgaagctcgattttgaccgcgacgaacaggaacagggctat
gcctgtctctggttgcgtatggcaaaaccttacgccggtgatacctacggctggcacgcg
cctttactcgatggcactgaagtcgccatcgctttcgattccggcgactgtgaccggcct
tatatcgcgtatgccctgcatgattcagcacacagtgaccatgtcaccgacgacaaccat
acgcgcaatgtcctgcgtactccgtctttcaacaagctgcggatggaagacaaacgctca
gaggaacacatcaagcttgcgaccgagtttggcaaaacgcagctgaacatggggcatctg
gtggatgcggaacgcgcacagcgcggtgccggttttgaaatcaggacggatgaacacggc
gtgatgcgcgcgggcaaagggatatttgtcagtgcagaagaacaactcaaggcgcaggga
aaagtgctggatatggatccggccctcggtcaaatccatcaggccaacaatgagatgcag
gctctgagtgatgccgccatgcaggctaccgcgctggcatcagatattcaaaagcagctc
agctttgtcgataaccgcctgacgcagttgcagtccgcggccattttagccagcgccccg
atgggcgtggcgcttaccagcggtgagcatttacagctggcagcccgacagaatctgatg
gtgaacgccggtaacaatgccgacgttggcgtcatgaaaaacctgttcatcggcgcaggt
gaagcgttaagcatgtttgtacataagcaggatgccacgctgattgccaatcagggacag
gtcactatccaggcgcaaaacaacgccatgtccctgaccgcaagacaaaccctgaccatc
accagctcggacgatgaaatcatcattaccactccgaaaaaactgaccctcaacggcggc
ggctcttatctgacgctggaggcaagtaaaatcgagcacgggtcttccggcgatatgacg
attaagtgcacgaactacctggtgccgatggtgggggcttcaaaaccaagcgatacacct
aaatttcctattgtcacgatggaaaacttgactgaagagaatgggaaggatttttctgga
taa

DBGET integrated database retrieval system